BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 014857
(417 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3DTF|A Chain A, Structural Analysis Of Mycobacterial Branched Chain
Aminotransferase- Implications For Inhibitor Design
pdb|3DTF|B Chain B, Structural Analysis Of Mycobacterial Branched Chain
Aminotransferase- Implications For Inhibitor Design
pdb|3DTG|A Chain A, Structural Analysis Of Mycobacterial Branched Chain
Aminotransferase- Implications For Inhibitor Design
pdb|3DTG|B Chain B, Structural Analysis Of Mycobacterial Branched Chain
Aminotransferase- Implications For Inhibitor Design
Length = 372
Score = 30.0 bits (66), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 15/41 (36%), Positives = 22/41 (53%)
Query: 130 KSTPLEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTV 170
S PLEFT++ + V +I AN G G Y H+V++
Sbjct: 6 NSGPLEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSI 46
>pdb|3JZ6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Branched
Chain Aminotransferase In Complex With
Pyridoxal-5'-Phosphate At 1.9 Angstrom.
pdb|3JZ6|B Chain B, Crystal Structure Of Mycobacterium Smegmatis Branched
Chain Aminotransferase In Complex With
Pyridoxal-5'-Phosphate At 1.9 Angstrom
Length = 373
Score = 30.0 bits (66), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 15/41 (36%), Positives = 22/41 (53%)
Query: 130 KSTPLEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTV 170
S PLEFT++ + V +I AN G G Y H+V++
Sbjct: 7 NSGPLEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSI 47
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.139 0.443
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,664,953
Number of Sequences: 62578
Number of extensions: 386056
Number of successful extensions: 921
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 919
Number of HSP's gapped (non-prelim): 3
length of query: 417
length of database: 14,973,337
effective HSP length: 101
effective length of query: 316
effective length of database: 8,652,959
effective search space: 2734335044
effective search space used: 2734335044
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)