BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014857
         (417 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3DTF|A Chain A, Structural Analysis Of Mycobacterial Branched Chain
           Aminotransferase- Implications For Inhibitor Design
 pdb|3DTF|B Chain B, Structural Analysis Of Mycobacterial Branched Chain
           Aminotransferase- Implications For Inhibitor Design
 pdb|3DTG|A Chain A, Structural Analysis Of Mycobacterial Branched Chain
           Aminotransferase- Implications For Inhibitor Design
 pdb|3DTG|B Chain B, Structural Analysis Of Mycobacterial Branched Chain
           Aminotransferase- Implications For Inhibitor Design
          Length = 372

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 130 KSTPLEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTV 170
            S PLEFT++       + V  +I AN G G  Y  H+V++
Sbjct: 6   NSGPLEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSI 46


>pdb|3JZ6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Branched
           Chain Aminotransferase In Complex With
           Pyridoxal-5'-Phosphate At 1.9 Angstrom.
 pdb|3JZ6|B Chain B, Crystal Structure Of Mycobacterium Smegmatis Branched
           Chain Aminotransferase In Complex With
           Pyridoxal-5'-Phosphate At 1.9 Angstrom
          Length = 373

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 130 KSTPLEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTV 170
            S PLEFT++       + V  +I AN G G  Y  H+V++
Sbjct: 7   NSGPLEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSI 47


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.139    0.443 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,664,953
Number of Sequences: 62578
Number of extensions: 386056
Number of successful extensions: 921
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 919
Number of HSP's gapped (non-prelim): 3
length of query: 417
length of database: 14,973,337
effective HSP length: 101
effective length of query: 316
effective length of database: 8,652,959
effective search space: 2734335044
effective search space used: 2734335044
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)