Citrus Sinensis ID: 014891


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------
MEMDSLPNGNSAAASPPQNPTPAAAGGMTPFPKLTQLTEALKLEHQFLRVPFEHYKKTIRTNHRAVEKEITSVISNVADVSDSENFSKDDAVNHLTSLVSRLQGLKRKLEEGSRTEHLQAQKCRARLNHLESADAENLAEWNNTRVKRILVDYMLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccHHHHHHHHHHccccEEEcccccccccccccEEEccc
**********************************TQLTEALKLEHQFLRVPFEHYKKTIRTNHRAVEKEITSVISNVA*****************TSLVSR*******************QKCRARLNHLESADAENLAEWNNTRVKRILVDYMLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMDSLPNGNSAAASPPQNPTPAAAGGMTPFPKLTQLTEALKLEHQFLRVPFEHYKKTIRTNHRAVEKEITSVISNVADVSDSENFSKDDAVNHLTSLVSRLQGLKRKLEEGSRTEHLQAQKCRARLNHLESADAENLAEWNNTRVKRILVDYMLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Macrophage erythroblast attacher Plays a role in erythroblast enucleation and in the development of the mature macrophages and mediates the attachment of erythroid cell to mature macrophages. Associates with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.probableQ3MHJ2
Macrophage erythroblast attacher May play a possible role in erythroblast and macrophages maturation. May associate with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.probableQ7SXR3
Protein fyv10 Involved in the proteasome-dependent degradation of fructose-1,6-bisphosphatase.probableQ5AS80

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AP4, chain A
Confidence level:probable
Coverage over the Query: 329-415
View the alignment between query and template
View the model in PyMOL
Template: 1UUJ, chain A
Confidence level:probable
Coverage over the Query: 140-173
View the alignment between query and template
View the model in PyMOL
Template: 1DEQ, chain A
Confidence level:probable
Coverage over the Query: 55-131
View the alignment between query and template
View the model in PyMOL
Template: 2NXP, chain A
Confidence level:probable
Coverage over the Query: 198-265
View the alignment between query and template
View the model in PyMOL