BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014901
         (416 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2GZA|A Chain A, Crystal Structure Of The Virb11 Atpase From The Brucella
           Suis Type Iv Secretion System In Complex With Sulphate
 pdb|2GZA|B Chain B, Crystal Structure Of The Virb11 Atpase From The Brucella
           Suis Type Iv Secretion System In Complex With Sulphate
 pdb|2GZA|C Chain C, Crystal Structure Of The Virb11 Atpase From The Brucella
           Suis Type Iv Secretion System In Complex With Sulphate
          Length = 361

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 238 MKALELWRESPAVL-LCIRRPGCIMC-RAEAHQLYAKKPIFDALGIQLFAVLHEYIESEV 295
           ++ L  W + P +  +C+ RPG + C RA A + YA   +     I L      +++ ++
Sbjct: 26  LEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDI 85

Query: 296 KDFWP 300
            D  P
Sbjct: 86  SDSRP 90


>pdb|3SEI|A Chain A, Crystal Structure Of Caskin1 Tandem Sams
 pdb|3SEI|B Chain B, Crystal Structure Of Caskin1 Tandem Sams
          Length = 149

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%)

Query: 47  TQQQKDALEIRSYLHDRALMQYADIFEASGKSLPELLNLSTGDLSSQFGMKRGHMARFKD 106
           T++ K +  +  +L    L  YA  F ++G  LP +  ++  DL++    K GH  +   
Sbjct: 4   TREGKSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAA 63

Query: 107 RTSACSDP 114
             S  S P
Sbjct: 64  EISGLSIP 71


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,925,162
Number of Sequences: 62578
Number of extensions: 402357
Number of successful extensions: 830
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 828
Number of HSP's gapped (non-prelim): 5
length of query: 416
length of database: 14,973,337
effective HSP length: 101
effective length of query: 315
effective length of database: 8,652,959
effective search space: 2725682085
effective search space used: 2725682085
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)