Citrus Sinensis ID: 014913

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------

MEEIDVPTFFLCPISLAIMKDPVTVPTGITYDRESIEKWLFAGKNNTCPMTKQVLSSECELTPNHTLRRLIQSWCTLNASYGIERIPTPKPPINKAQITKLLNEAAKSPQMQIKCLKKLRSIAAENETNKRCLESAGAVEFLASFVTNSNAMEESPEGFDNLHESSRPVDEALSILCNLKISELGLKSLVMGRNGTFVDSLTQIMQRGTYESRAYAVLLLKSMLEVAEPMQLISLRQELFVEVIQVLHDHISQQASKSALEVLVNICPWGRNRIKGVEAGAVSILIDLLLDSSLERRASEMILTVLDLLCQCAEGRAELLKHGAGLAIVSKKILRVSQVASERAVRILLSISKFSATNSVLQEMLQIGVVAKLCLVLQVDNSMKTKDKAREVLKLHARAWKNSPCVPENLRSLFPA

ccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHccccc

*EEIDVPTFFLCPISLAIMKDPVTVPTGITYDRESIEKWLFAGKNNTCPMTKQVLSSECELTPNHTLRRLIQSWCTLNASYGIERIPTPKPPINKAQITKLLNEAAKSPQMQIKCLKKLRSIAAENETNKRCLESAGAVEFLASFV****************HESSRPVDEALSILCNLKISELGLKSLVMGRNGTFVDSLTQIMQRGTYESRAYAVLLLKSMLEVAEPMQLISLRQELFVEVIQVLHDHISQQASKSALEVLVNICPWGRNRIKGVEAGAVSILIDLLLDSSLERRASEMILTVLDLLCQCAEGRAELLKHGAGLAIVSKKILRVSQVASERAVRILLSISKFSATNSVLQEMLQIGVVAKLCLVLQVDNSM*TKDKAREVLKLHARAWKNSPCVPENL*SLFP*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase PUB22	E3 ubiquitin-protein ligase that negatively regulates water stress response. May control in coordination with PUB23 a drought signaling pathway by ubiquitinating cytosolic RPN12a. Acts as negative regulator of the immunity triggered by the pathogen-associated molecular patterns (PAMPs), in association with PUB23 and PUB24.	probable	Q9SVC6

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JDH, chain A
Confidence level:very confident
Coverage over the Query: 95-149,165-398
View the alignment between query and template
View the model in PyMOL

Template: 2F42, chain A
Confidence level:very confident
Coverage over the Query: 3-79
View the alignment between query and template
View the model in PyMOL