BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014917
         (416 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
           Crystallized Without Acetyl Coenzyme-A
 pdb|3TW7|B Chain B, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
           Crystallized Without Acetyl Coenzyme-A
 pdb|3TW6|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
           With The Allosteric Activator, Acetyl Coenzyme-A
 pdb|3TW6|B Chain B, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
           With The Allosteric Activator, Acetyl Coenzyme-A
 pdb|3TW6|C Chain C, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
           With The Allosteric Activator, Acetyl Coenzyme-A
 pdb|3TW6|D Chain D, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
           With The Allosteric Activator, Acetyl Coenzyme-A
          Length = 1165

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 10  NLTRTVRSYADTVVQTAGNAVTEGAKIITDRIGARNFNNFRQTAKRL 56
           N  R V  YA+      GN V +G K + D +G + F  + +  KR+
Sbjct: 511 NAARPVVPYAN------GNGVKDGTKQLLDTLGPKKFGEWMRNEKRV 551


>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate
           Carboxylase From Rhizobium Etli
 pdb|2QF7|B Chain B, Crystal Structure Of A Complete Multifunctional Pyruvate
           Carboxylase From Rhizobium Etli
          Length = 1165

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 10  NLTRTVRSYADTVVQTAGNAVTEGAKIITDRIGARNFNNFRQTAKRL 56
           N  R V  YA+      GN V +G K + D +G + F  + +  KR+
Sbjct: 511 NAARPVVPYAN------GNGVKDGTKQLLDTLGPKKFGEWMRNEKRV 551


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.131    0.359 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,083,071
Number of Sequences: 62578
Number of extensions: 436520
Number of successful extensions: 1102
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 17
Number of HSP's that attempted gapping in prelim test: 1089
Number of HSP's gapped (non-prelim): 26
length of query: 416
length of database: 14,973,337
effective HSP length: 101
effective length of query: 315
effective length of database: 8,652,959
effective search space: 2725682085
effective search space used: 2725682085
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (25.0 bits)