BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 014917
(416 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
Crystallized Without Acetyl Coenzyme-A
pdb|3TW7|B Chain B, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
Crystallized Without Acetyl Coenzyme-A
pdb|3TW6|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
With The Allosteric Activator, Acetyl Coenzyme-A
pdb|3TW6|B Chain B, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
With The Allosteric Activator, Acetyl Coenzyme-A
pdb|3TW6|C Chain C, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
With The Allosteric Activator, Acetyl Coenzyme-A
pdb|3TW6|D Chain D, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a
With The Allosteric Activator, Acetyl Coenzyme-A
Length = 1165
Score = 28.5 bits (62), Expect = 6.4, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%)
Query: 10 NLTRTVRSYADTVVQTAGNAVTEGAKIITDRIGARNFNNFRQTAKRL 56
N R V YA+ GN V +G K + D +G + F + + KR+
Sbjct: 511 NAARPVVPYAN------GNGVKDGTKQLLDTLGPKKFGEWMRNEKRV 551
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate
Carboxylase From Rhizobium Etli
pdb|2QF7|B Chain B, Crystal Structure Of A Complete Multifunctional Pyruvate
Carboxylase From Rhizobium Etli
Length = 1165
Score = 28.5 bits (62), Expect = 6.4, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%)
Query: 10 NLTRTVRSYADTVVQTAGNAVTEGAKIITDRIGARNFNNFRQTAKRL 56
N R V YA+ GN V +G K + D +G + F + + KR+
Sbjct: 511 NAARPVVPYAN------GNGVKDGTKQLLDTLGPKKFGEWMRNEKRV 551
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.131 0.359
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,083,071
Number of Sequences: 62578
Number of extensions: 436520
Number of successful extensions: 1102
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 17
Number of HSP's that attempted gapping in prelim test: 1089
Number of HSP's gapped (non-prelim): 26
length of query: 416
length of database: 14,973,337
effective HSP length: 101
effective length of query: 315
effective length of database: 8,652,959
effective search space: 2725682085
effective search space used: 2725682085
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (25.0 bits)