BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014962
         (415 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1A0T|P Chain P, Sucrose-Specific Porin, With Bound Sucrose Molecules
 pdb|1A0T|Q Chain Q, Sucrose-Specific Porin, With Bound Sucrose Molecules
 pdb|1A0T|R Chain R, Sucrose-Specific Porin, With Bound Sucrose Molecules
 pdb|1A0S|P Chain P, Sucrose-Specific Porin
 pdb|1A0S|Q Chain Q, Sucrose-Specific Porin
 pdb|1A0S|R Chain R, Sucrose-Specific Porin
 pdb|1OH2|P Chain P, Sucrose-Specific Porin, With Bound Sucrose Molecules
 pdb|1OH2|R Chain R, Sucrose-Specific Porin, With Bound Sucrose Molecules
          Length = 413

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 85  GTSLSSGPAIMPSGEAESTKGRL-------IVLCIEHMQNSDCGSMT 124
           G S  SG  I P+GE     GRL       + + +EH Q  D G+ T
Sbjct: 19  GASTKSGAYITPAGETGGAIGRLGNQADTYVEMNLEHKQTLDNGATT 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.135    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,957,558
Number of Sequences: 62578
Number of extensions: 399497
Number of successful extensions: 679
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 679
Number of HSP's gapped (non-prelim): 1
length of query: 415
length of database: 14,973,337
effective HSP length: 101
effective length of query: 314
effective length of database: 8,652,959
effective search space: 2717029126
effective search space used: 2717029126
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)