BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014966
         (415 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3L4G|B Chain B, Crystal Structure Of Homo Sapiens Cytoplasmic
           Phenylalanyl-T Synthetase
 pdb|3L4G|D Chain D, Crystal Structure Of Homo Sapiens Cytoplasmic
           Phenylalanyl-T Synthetase
 pdb|3L4G|F Chain F, Crystal Structure Of Homo Sapiens Cytoplasmic
           Phenylalanyl-T Synthetase
 pdb|3L4G|H Chain H, Crystal Structure Of Homo Sapiens Cytoplasmic
           Phenylalanyl-T Synthetase
 pdb|3L4G|J Chain J, Crystal Structure Of Homo Sapiens Cytoplasmic
           Phenylalanyl-T Synthetase
 pdb|3L4G|L Chain L, Crystal Structure Of Homo Sapiens Cytoplasmic
           Phenylalanyl-T Synthetase
 pdb|3L4G|N Chain N, Crystal Structure Of Homo Sapiens Cytoplasmic
           Phenylalanyl-T Synthetase
 pdb|3L4G|P Chain P, Crystal Structure Of Homo Sapiens Cytoplasmic
           Phenylalanyl-T Synthetase
          Length = 589

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 317 FPKTYTKENIMPADKKEKFL--DSADSEFEKVIDFYLCSQSD 356
            PKTYT  N  P +K  + L  D A + F + + F LCSQ D
Sbjct: 381 LPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQED 422


>pdb|2CSU|A Chain A, Crystal Structure Of Ph0766 From Pyrococcus Horikoshii Ot3
 pdb|2CSU|B Chain B, Crystal Structure Of Ph0766 From Pyrococcus Horikoshii Ot3
          Length = 457

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 131 ERKFEDVYDVNKFIRSLDGV--VKVVKELPEEISFRNLAVVKVPNRVTEDHIIE 182
           E K   VY VN     + GV   K VK++P+EI   +LA++ VP R  +D +I+
Sbjct: 33  EYKKGKVYPVNIKEEEVQGVKAYKSVKDIPDEI---DLAIIVVPKRFVKDTLIQ 83


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.136    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,821,227
Number of Sequences: 62578
Number of extensions: 487896
Number of successful extensions: 1325
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 1324
Number of HSP's gapped (non-prelim): 8
length of query: 415
length of database: 14,973,337
effective HSP length: 101
effective length of query: 314
effective length of database: 8,652,959
effective search space: 2717029126
effective search space used: 2717029126
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)