Citrus Sinensis ID: 015091


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MMQPAPGAVPPPPPPMAAHQYQYQQQAPPQQQPPPQPSPYMMMMPPQPQAQPPAMWATQAAAPQAAGVAVPPQQQGQPGEIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQTFNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDYMLQETFRARYPSTKGAKVVIDRLTGRTKGYGFVRFGDESEQLRAMTEMNGVFCSTRPMRIGPATNKKTVSGQQQYPKASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPSNKQAQPDPNQWNAGYYGYAQGYENYGYAAAAPQDPSMYYGGYPGYGNYQQPQQPQQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHcccccccccccEEEEccccccccccccccccEEEEccccccccHHHHHHHHcccccccEEEEEEEEccccccccEEEEECccHHHHHHHHHHcccccccccccEEcccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEcccccCEEEEcccHHHHHHHHHHHcccEEccCEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
********************************************************************************IRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQTFNGTPMPNGEQNFRLNWASFGAG*****TPDHTIFVGDLAADVTDYMLQETFRARYPSTKGAKVVIDRLTGRTKGYGFVRFGDESEQLRAMTEMNGVFCSTRPMRIG****************************DDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSW**************QWNAGYYGYAQGYENYGYAAAAPQDPSMYYGGYPG************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMQPAPGAVPPPPPPMAAHQYQYQQQAPPQQQPPPQPSPYMMMMPPQPQAQPPAMWATQAAAPQAAGVAVPPQQQGQPGEIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQTFNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDYMLQETFRARYPSTKGAKVVIDRLTGRTKGYGFVRFGDESEQLRAMTEMNGVFCSTRPMRIGPATNKKTVSGQQQYPKASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPSNKQAQPDPNQWNAGYYGYAQGYENYGYAAAAPQDPSMYYGGYPGYGNYQQPQQPQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyadenylate-binding protein RBP45B Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.probableQ9SAB3
Polyadenylate-binding protein RBP45 Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.probableQ9LEB4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FXL, chain A
Confidence level:very confident
Coverage over the Query: 81-251
View the alignment between query and template
View the model in PyMOL
Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 169-253,281-354
View the alignment between query and template
View the model in PyMOL
Template: 1H2T, chain Z
Confidence level:probable
Coverage over the Query: 262-376
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 25-37
View the alignment between query and template
View the model in PyMOL