Citrus Sinensis ID: 015143

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
MAEAAETEATEHPWMSPEKTEINGRDLTITVLTVGDDRHERGGLAASQSNETTSNVSDGKLGLGERAFSAAGAAFLSAIIVNPLDVAKTRLQAQAAGVAYSHPLSNLISRMAYFGPRTMFADLRCSPSCTRAGVHGTVSMCPPDCFQYRGTLDVFYKIIRQEGFSRLWRGTNAGLALAVPTVGIYLPCYDVFRNWLEEATDKNAPSATPYVPLVAGSLARSLACATCYPIELARTRMQAFKGNQIGKKPPGVWQTLLGVLSHVKSTNNIQKGFQGYRILWTGMGTQLARDVPFSAICWSTLEPMRRRLLSFVGEDSNAASVLGANFSAAFVAGSLAAAATCPLDVAKTRRQIEKDPGRAMRMTTRQTLMEVWREAGIKGLFTGVGPRVARAGPSVGIVVSFYEVVKYVLHNR
cHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHEEcHHHHHHHHHHccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcHHHHHHHHHHHEEcHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccccHHHccccHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccHHHHHHHHHHHHcHHHHcccccccHHHccccHHHHHHHHHHHHHHHHcc
*************************DLTITVLTV****************************LGERAFSAAGAAFLSAIIVNPLDVAKTRLQAQAAGVAYSHPLSNLISRMAYFGPRTMFADLRCSPSCTRAGVHGTVSMCPPDCFQYRGTLDVFYKIIRQEGFSRLWRGTNAGLALAVPTVGIYLPCYDVFRNWLEEATDKNAPSATPYVPLVAGSLARSLACATCYPIELARTRMQAFKGNQIGKKPPGVWQTLLGVLSHVKSTNNIQKGFQGYRILWTGMGTQLARDVPFSAICWSTLEPMRRRLLSFVGEDSNAASVLGANFSAAFVAGSLAAAATCPLDVAKT**************TTRQTLMEVWREAGIKGLFTGVGPRVARAGPSVGIVVSFYEVVKYVLHN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEAAETEATEHPWMSPEKTEINGRDLTITVLTVGDDRHERGGLAASQSNETTSNVSDGKLGLGERAFSAAGAAFLSAIIVNPLDVAKTRLQAQAAGVAYSHPLSNLISRMAYFGPRTMFADLRCSPSCTRAGVHGTVSMCPPDCFQYRGTLDVFYKIIRQEGFSRLWRGTNAGLALAVPTVGIYLPCYDVFRNWLEEATDKNAPSATPYVPLVAGSLARSLACATCYPIELARTRMQAFKGNQIGKKPPGVWQTLLGVLSHVKSTNNIQKGFQGYRILWTGMGTQLARDVPFSAICWSTLEPMRRRLLSFVGEDSNAASVLGANFSAAFVAGSLAAAATCPLDVAKTRRQIEKDPGRAMRMTTRQTLMEVWREAGIKGLFTGVGPRVARAGPSVGIVVSFYEVVKYVLHNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial carrier protein MTM1 Involved in the mitochondrial activation of MSD1 by specifically facilitating insertion of the essential manganese cofactor. Has the ability to activate iron regulon in an iron-dependent manner.probableQ944H5
Mitochondrial carrier protein MTM1 Involved in the mitochondrial activation of SOD2 by specifically facilitating insertion of the essential manganese cofactor. Has the ability to activate iron regulon in an iron-dependent manner. Responds to calorie restriction (CR) strength.probableP53320

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 65-101,141-263,275-411
View the alignment between query and template
View the model in PyMOL