BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015153
         (412 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ZTV|A Chain A, Structure Of Haemophilus Influenzae Nad Nucleotidase
           (Nadn)
 pdb|3ZU0|A Chain A, Structure Of Haemophilus Influenzae Nad Nucleotidase
           (Nadn)
 pdb|3ZU0|B Chain B, Structure Of Haemophilus Influenzae Nad Nucleotidase
           (Nadn)
          Length = 579

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 118 GGSTIRVPDRILPTNEGFGFSPFYLDIQLSQFMLFKSRSQMIRQRGGIYASLMPQEEYFS 177
           GGS  R+P++     EG   + F   I  + +   K+    I+  GG+ A ++P    F+
Sbjct: 368 GGSANRIPNKAGSNPEGSIATRF---IAETMYNELKTVDLTIQNAGGVRADILPGNVTFN 424

Query: 178 QALYTF 183
            A YTF
Sbjct: 425 DA-YTF 429


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.138    0.427 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,068,163
Number of Sequences: 62578
Number of extensions: 584392
Number of successful extensions: 927
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 927
Number of HSP's gapped (non-prelim): 13
length of query: 412
length of database: 14,973,337
effective HSP length: 101
effective length of query: 311
effective length of database: 8,652,959
effective search space: 2691070249
effective search space used: 2691070249
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)