BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 015153
(412 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ZTV|A Chain A, Structure Of Haemophilus Influenzae Nad Nucleotidase
(Nadn)
pdb|3ZU0|A Chain A, Structure Of Haemophilus Influenzae Nad Nucleotidase
(Nadn)
pdb|3ZU0|B Chain B, Structure Of Haemophilus Influenzae Nad Nucleotidase
(Nadn)
Length = 579
Score = 28.5 bits (62), Expect = 6.8, Method: Compositional matrix adjust.
Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 4/66 (6%)
Query: 118 GGSTIRVPDRILPTNEGFGFSPFYLDIQLSQFMLFKSRSQMIRQRGGIYASLMPQEEYFS 177
GGS R+P++ EG + F I + + K+ I+ GG+ A ++P F+
Sbjct: 368 GGSANRIPNKAGSNPEGSIATRF---IAETMYNELKTVDLTIQNAGGVRADILPGNVTFN 424
Query: 178 QALYTF 183
A YTF
Sbjct: 425 DA-YTF 429
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.138 0.427
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,068,163
Number of Sequences: 62578
Number of extensions: 584392
Number of successful extensions: 927
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 927
Number of HSP's gapped (non-prelim): 13
length of query: 412
length of database: 14,973,337
effective HSP length: 101
effective length of query: 311
effective length of database: 8,652,959
effective search space: 2691070249
effective search space used: 2691070249
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)