BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015154
         (412 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2F15|A Chain A, Glycogen-Binding Domain Of The Amp-Activated Protein
           Kinase Beta2 Subunit
          Length = 96

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 14/88 (15%)

Query: 325 IQYSGDGEIVEVAGSFNGWHHRIKMDXXXXXXXXXXXXXXXXXLWSTVLWLYPGTYEIKF 384
           I++S  G+ V ++GSFN W  +I +                   +  +L L  G ++ KF
Sbjct: 14  IRWSEGGKEVFISGSFNNWSTKIPLIKSHND-------------FVAILDLPEGEHQYKF 60

Query: 385 IVDGQWKVDPQRESVTKG-GICNNILRV 411
            VDGQW  DP    VT   G  NN++ V
Sbjct: 61  FVDGQWVHDPSEPVVTSQLGTINNLIHV 88


>pdb|1Z0M|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein
           Kinase Beta1 Subunit
 pdb|1Z0M|B Chain B, The Glycogen-Binding Domain Of The Amp-Activated Protein
           Kinase Beta1 Subunit
 pdb|1Z0M|C Chain C, The Glycogen-Binding Domain Of The Amp-Activated Protein
           Kinase Beta1 Subunit
          Length = 96

 Score = 40.4 bits (93), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 15/87 (17%)

Query: 326 QYSGDGEIVEVAGSFNGWHHRIKMDXXXXXXXXXXXXXXXXXLWSTVLWLYPGTYEIKFI 385
           +++G G+ V ++GSFN W  ++ +                   +  +L L  G ++ KF 
Sbjct: 16  RWTGGGKEVYLSGSFNNWS-KLPLTRSQNN-------------FVAILDLPEGEHQYKFF 61

Query: 386 VDGQWKVDPQRESVTKG-GICNNILRV 411
           VDGQW  DP    VT   G  NNI++V
Sbjct: 62  VDGQWTHDPSEPIVTSQLGTVNNIIQV 88


>pdb|1Z0N|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein
           Kinase
 pdb|1Z0N|B Chain B, The Glycogen-Binding Domain Of The Amp-Activated Protein
           Kinase
 pdb|1Z0N|C Chain C, The Glycogen-Binding Domain Of The Amp-Activated Protein
           Kinase
          Length = 96

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 15/87 (17%)

Query: 326 QYSGDGEIVEVAGSFNGWHHRIKMDXXXXXXXXXXXXXXXXXLWSTVLWLYPGTYEIKFI 385
           +++G G+ V ++GSFN W                         +  +L L  G ++ KF 
Sbjct: 16  RWTGGGKEVYLSGSFNNW--------------SKLPXTRSQNNFVAILDLPEGEHQYKFF 61

Query: 386 VDGQWKVDPQRESVTKG-GICNNILRV 411
           VDGQW  DP    VT   G  NNI++V
Sbjct: 62  VDGQWTHDPSEPIVTSQLGTVNNIIQV 88


>pdb|2QLV|B Chain B, Crystal Structure Of The Heterotrimer Core Of The S.
           Cerevisiae Ampk Homolog Snf1
 pdb|2QLV|E Chain E, Crystal Structure Of The Heterotrimer Core Of The S.
           Cerevisiae Ampk Homolog Snf1
          Length = 252

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 10/70 (14%)

Query: 323 VEIQYSGDGEIVEVAGSFNGWHHRIKMDXXXXXXXXXXXXXXXXXLWSTVLWLYPGTYEI 382
           VEI++   G  V V GSF  W   I +                   +   L L PGT+  
Sbjct: 6   VEIRWQQGGSKVYVTGSFTKWRKMIGL----------IPDSDNNGSFHVKLRLLPGTHRF 55

Query: 383 KFIVDGQWKV 392
           +FIVD + +V
Sbjct: 56  RFIVDNELRV 65


>pdb|3OV9|A Chain A, Structure Of The Nucleoprotein From Rift Valley Fever
           Virus
 pdb|3OV9|B Chain B, Structure Of The Nucleoprotein From Rift Valley Fever
           Virus
 pdb|3OV9|C Chain C, Structure Of The Nucleoprotein From Rift Valley Fever
           Virus
          Length = 245

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 155 CFPKSLSDPSFVGEVSPNLNGHYEKADMEEKVANFIQ 191
            +P+ +  PSF G V P+L G Y +A ++      +Q
Sbjct: 139 AYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQ 175


>pdb|3LYF|A Chain A, Crystal Structure Of The Rift Valley Fever Virus
           Nucleocapsid Protein
 pdb|3LYF|B Chain B, Crystal Structure Of The Rift Valley Fever Virus
           Nucleocapsid Protein
 pdb|3LYF|C Chain C, Crystal Structure Of The Rift Valley Fever Virus
           Nucleocapsid Protein
 pdb|3LYF|D Chain D, Crystal Structure Of The Rift Valley Fever Virus
           Nucleocapsid Protein
 pdb|4H5M|A Chain A, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer
 pdb|4H5M|B Chain B, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer
 pdb|4H5M|C Chain C, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer
 pdb|4H5M|D Chain D, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer
 pdb|4H5M|E Chain E, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer
 pdb|4H5M|F Chain F, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer
 pdb|4H5O|A Chain A, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|B Chain B, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|C Chain C, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|D Chain D, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|E Chain E, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|F Chain F, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|G Chain G, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|H Chain H, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|I Chain I, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5O|J Chain J, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Pentamer Bound To Single-Stranded Rna
 pdb|4H5P|A Chain A, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Tetramer Bound To Single-Stranded Rna
 pdb|4H5P|B Chain B, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Tetramer Bound To Single-Stranded Rna
 pdb|4H5P|C Chain C, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Tetramer Bound To Single-Stranded Rna
 pdb|4H5P|D Chain D, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Tetramer Bound To Single-Stranded Rna
 pdb|4H5Q|A Chain A, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Dna
 pdb|4H5Q|B Chain B, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Dna
 pdb|4H5Q|C Chain C, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Dna
 pdb|4H6F|A Chain A, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|B Chain B, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|C Chain C, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|D Chain D, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|E Chain E, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|F Chain F, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|G Chain G, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|H Chain H, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|I Chain I, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|J Chain J, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|K Chain K, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|L Chain L, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|M Chain M, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|N Chain N, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|O Chain O, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|P Chain P, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|Q Chain Q, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6F|R Chain R, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|A Chain A, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|B Chain B, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|C Chain C, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|D Chain D, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|E Chain E, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|F Chain F, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|G Chain G, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|H Chain H, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|I Chain I, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|J Chain J, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|K Chain K, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|L Chain L, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|M Chain M, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|N Chain N, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|O Chain O, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|P Chain P, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|Q Chain Q, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna.
 pdb|4H6G|R Chain R, Crystal Structure Of Rift Valley Fever Virus Nucleocapsid
           Protein Hexamer Bound To Single-Stranded Rna. This Entry
           Contains Three Out Of Six Hexamers Bound To Rna
          Length = 245

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 155 CFPKSLSDPSFVGEVSPNLNGHYEKADMEEKVANFIQ 191
            +P+ +  PSF G V P+L G Y +A ++      +Q
Sbjct: 139 AYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQ 175


>pdb|3NME|A Chain A, Structure Of A Plant Phosphatase
 pdb|3NME|B Chain B, Structure Of A Plant Phosphatase
          Length = 294

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 32/81 (39%), Gaps = 13/81 (16%)

Query: 334 VEVAGSFNGWHHRIKMDXXXXXXXXXXXXXXXXXLWSTVLWLYPGTYEIKFIVDGQWKVD 393
           VE++G   GW  RI +                   W     L  G +E K+I+DG+W  +
Sbjct: 184 VEISGLDIGWGQRIPL-----------TLGKGTGFWILKRELPEGQFEYKYIIDGEWTHN 232

Query: 394 PQRESV--TKGGICNNILRVI 412
                +   K G  NN  +V+
Sbjct: 233 EAEPFIGPNKDGHTNNYAKVV 253


>pdb|1YGG|A Chain A, Crystal Structure Of Phosphoenolpyruvate Carboxykinase
           From Actinobacillus Succinogenes
 pdb|1YLH|A Chain A, Crystal Structure Of Phosphoenolpyruvate Carboxykinase
           From Actinobaccilus Succinogenes In Complex With
           Manganese And Pyruvate
          Length = 560

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 85  MKELSAHGRDDLANIVRRRGYKFIRQLLKSSTKPGFNGF 123
           +KEL+  G  D+  IV    Y+   QL +  TKPG  GF
Sbjct: 30  VKELNDLGLTDVKEIVYNPSYE---QLFEEETKPGLEGF 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.133    0.387 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,054,922
Number of Sequences: 62578
Number of extensions: 342157
Number of successful extensions: 950
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 11
Number of HSP's that attempted gapping in prelim test: 938
Number of HSP's gapped (non-prelim): 21
length of query: 412
length of database: 14,973,337
effective HSP length: 101
effective length of query: 311
effective length of database: 8,652,959
effective search space: 2691070249
effective search space used: 2691070249
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)