BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015164
         (412 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4A2L|A Chain A, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2L|B Chain B, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2L|C Chain C, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2L|D Chain D, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2L|E Chain E, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2L|F Chain F, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2M|A Chain A, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2M|B Chain B, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2M|C Chain C, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
 pdb|4A2M|D Chain D, Structure Of The Periplasmic Domain Of The Heparin And
           Heparan Sulphate Sensing Hybrid Two Component System
           Bt4663 In Apo And Ligand Bound Forms
          Length = 795

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 41  KHINNLVFYVFNPALVASNLANTITYESMLKLWFMPFNVLITFLVGS 87
           K I N +    NP  ++SN   ++  +S  +LW   FN L  +  G+
Sbjct: 245 KEIKNYLHSPSNPKSISSNYIRSLAMDSQNRLWIGTFNDLNIYHEGT 291


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,847,324
Number of Sequences: 62578
Number of extensions: 409526
Number of successful extensions: 969
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 965
Number of HSP's gapped (non-prelim): 5
length of query: 412
length of database: 14,973,337
effective HSP length: 101
effective length of query: 311
effective length of database: 8,652,959
effective search space: 2691070249
effective search space used: 2691070249
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)