BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015171
         (412 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGL|B Chain B, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|D Chain D, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|F Chain F, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|H Chain H, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|J Chain J, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|L Chain L, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|N Chain N, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|P Chain P, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGM|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
          Length = 592

 Score = 31.6 bits (70), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 5/68 (7%)

Query: 129 RNLPEIIFYVESLHVLELSYCKLQQPSENVKLFSLRKLALREVCADDQAIASLISGCPLI 188
           + L    FY+    + +L    + Q S NV     R + L  V   D+ +     GCP +
Sbjct: 436 KKLRRFAFYLRQGGLTDLGLSYIGQYSPNV-----RWMLLGYVGESDEGLMEFSRGCPNL 490

Query: 189 EYLEIRSC 196
           + LE+R C
Sbjct: 491 QKLEMRGC 498


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,613,816
Number of Sequences: 62578
Number of extensions: 429409
Number of successful extensions: 859
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 855
Number of HSP's gapped (non-prelim): 11
length of query: 412
length of database: 14,973,337
effective HSP length: 101
effective length of query: 311
effective length of database: 8,652,959
effective search space: 2691070249
effective search space used: 2691070249
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)