Citrus Sinensis ID: 015221

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-

MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELMPKGREKESQAKIKRYMTMMDSMTNEGKQLLFMCFAFINNLMSWIVQILSS

cHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEccccccccccccccHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHccccccccccccccccHHHHHHHHHHHHHHccccHHHHccccccccccccHHHHHHHHccc

MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPG*******************RYMTMMDSMTNEGKQLLFMCFAFINNLMSWIVQILS*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal recognition particle 54 kDa protein 1	Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).	probable	P49971
Signal recognition particle 54 kDa protein 2	Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).	probable	P49972
Signal recognition particle 54 kDa protein	Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nascent chain (RNC) as it emerges from the ribosomes. The SRP-RNC complex is then targeted to the cytoplasmic membrane where it interacts with the SRP receptor FtsY.	probable	O27376

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J37, chain W
Confidence level:very confident
Coverage over the Query: 8-394
View the alignment between query and template
View the model in PyMOL