BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015238
         (411 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2DVT|A Chain A, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           From Rhizobium
 pdb|2DVT|B Chain B, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           From Rhizobium
 pdb|2DVT|C Chain C, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           From Rhizobium
 pdb|2DVT|D Chain D, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           From Rhizobium
 pdb|2DVU|A Chain A, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           Complexed With 2,6-Dihydroxybenzoate
 pdb|2DVU|B Chain B, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           Complexed With 2,6-Dihydroxybenzoate
 pdb|2DVU|C Chain C, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           Complexed With 2,6-Dihydroxybenzoate
 pdb|2DVU|D Chain D, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           Complexed With 2,6-Dihydroxybenzoate
 pdb|2DVX|A Chain A, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           Complexed With Inhibitor 2,3-Dihydroxybenzaldehyde
 pdb|2DVX|B Chain B, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           Complexed With Inhibitor 2,3-Dihydroxybenzaldehyde
 pdb|2DVX|C Chain C, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           Complexed With Inhibitor 2,3-Dihydroxybenzaldehyde
 pdb|2DVX|D Chain D, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
           Complexed With Inhibitor 2,3-Dihydroxybenzaldehyde
          Length = 327

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query: 158 PLYWAAQGTMFWALFVLGHDCGHGSFSNDHKLNSVVGHLLHSSILVPYHGWRISHRT 214
           P +  AQ T   AL ++      G F    +LN ++GH+      +PY  WRI HR 
Sbjct: 185 PTWAFAQETAVHALRLMAS----GLFDEHPRLNIILGHMGEG---LPYMMWRIDHRN 234


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.484 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,109,785
Number of Sequences: 62578
Number of extensions: 542025
Number of successful extensions: 1508
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1507
Number of HSP's gapped (non-prelim): 4
length of query: 411
length of database: 14,973,337
effective HSP length: 101
effective length of query: 310
effective length of database: 8,652,959
effective search space: 2682417290
effective search space used: 2682417290
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)