Citrus Sinensis ID: 015264


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDLLRERSRQRSELRRRQEEEMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQASSSGTAVTSAAKDKSSNLPAGGGQSSGGTRGNTTQGADFEAKVAKLVELGFGREAVIQALKLFDGNEEQAAGFLFGG
cEEEEEEccccEEEEEccccccHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcEEEEEEEEEccCEEEEEEccccccccccHHHHHHHccccccccccccccccccccccccEEEEEEEEEccCEEEEEEEEEccccccHHHcHHHHHHccccccccccEEEEcccCEEECcccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHcc
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSP***********SAVNPAA*********NLMTQLFQ***ELAQVLLGNDL*************************ALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQE*******************************************************FEAKVAKLVELGFGREAVIQALKLFDGNEEQAAGFLFGG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDxxxxxxxxxxxxxxxxxxxxxxxxEMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQASSSGTAVTSAAKDKSSNLPAGGGQSSGGTRGNTTQGADFEAKVAKLVELGFGREAVIQALKLFDGNEEQAAGFLFGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA damage-inducible protein 1 Acts as a linker between the 19S proteasome and polyubiquitinated proteins via UBA domain interactions with ubiquitin for their subsequent degradation. Required for S-phase checkpoint control and may be involved in the regulation of exocytosis.probableQ4WGS4
DNA damage-inducible protein 1 Acts as a linker between the 19S proteasome and polyubiquitinated proteins via UBA domain interactions with ubiquitin for their subsequent degradation. Required for S-phase checkpoint control and may be involved in the regulation of exocytosis.probableQ6BK42
DNA damage-inducible protein 1 Acts as a linker between the 19S proteasome and polyubiquitinated proteins like the HO endonuclease and UFO1 via UBA domain interactions with ubiquitin for their subsequent degradation. Required for S-phase checkpoint control. Appears to act as negative regulator of constitutive exocytosis. May act at the level of secretory vesicle docking and fusion as a competitive inhibitor of SNARE assembly.probableP40087

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I1A, chain A
Confidence level:very confident
Coverage over the Query: 193-240,252-320
View the alignment between query and template
View the model in PyMOL
Template: 3B08, chain A
Confidence level:very confident
Coverage over the Query: 1-73
View the alignment between query and template
View the model in PyMOL
Template: 1IFY, chain A
Confidence level:confident
Coverage over the Query: 369-410
View the alignment between query and template
View the model in PyMOL
Template: 2QSF, chain X
Confidence level:confident
Coverage over the Query: 94-135
View the alignment between query and template
View the model in PyMOL
Template: 1PVE, chain A
Confidence level:probable
Coverage over the Query: 116-160
View the alignment between query and template
View the model in PyMOL