Citrus Sinensis ID: 015268

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410

MFRKTCSWIRDMGCCSCFGFTRRKPKQALRPITGLNYRISRDFLLGDDIDDDDDDNSYNGEATNTADGDGGEMQNHAKRSEEIFRERELNGLICRQFPVKESNKLIRSEDENGTKMINEYVHVRKIGAGSYGKVVLYRSSLDGKHYAIKAFHKSHLSKLRVAPSETAMTDVRREVLIMKMLQHPNIVNLIEVIDDPNSDHFYMVLEYVEGKWDNDGFGQPGAIGESMARKYLRDIVSGLMYLHGHNVVHGDIKPDNLLVAPSGTVKIGDFSVSQVFEDDNDVLRRSPGTPVFTAPECCLGLTYGGKAADTWAVGVTLYYMIIGQYPFLGETLQDTYDKIVNNSLVFPDAMNPELRNLLEGLLCKDPTRRLTLNDVAKHTWVLGDNGPIPQYLCWCKRDRLRRDNTTQDSN

cccccHHHHccccccCCcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEEEcccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEEcccccEEEEEEEEEccccccEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEECcccccccccccccccccccccccccccccccccccccccccEEcHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccc

****TCSWIRDMGCCSCFGFTRRKPKQALRPITGLNYRISRDFLLGD*******************************************************************KMINEYVHVRKIGAGSYGKVVLYRSSLDGKHYAIKAFHKSHLSKLRVAPSETAMTDVRREVLIMKMLQHPNIVNLIEVIDDPNSDHFYMVLEYVEGKWDNDGFGQPGAIGESMARKYLRDIVSGLMYLHGHNVVHGDIKPDNLLVAPSGTVKIGDFSVSQVFEDDNDVLRRSPGTPVFTAPECCLGLTYGGKAADTWAVGVTLYYMIIGQYPFLGETLQDTYDKIVNNSLVFPDAMNPELRNLLEGLLCKDPTRRLTLNDVAKHTWVLGDNGPIPQYLCW****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein kinase GRIK2	Activates SnRK1.1/KIN10 and SnRK1.2/KIN11 by phosphorylation of their activation-loop 'Thr-198' and 'Thr-176', respectively. Required for the regulation by SnRK1 kinases of the transcription of a large set of genes, the modification the activity of metabolic enzymes, and the control of various nutrient-responsive cellular developmental processes.	probable	Q5HZ38

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I6U, chain A
Confidence level:very confident
Coverage over the Query: 3-277,290-384
View the alignment between query and template
View the model in PyMOL

Template: 1VYW, chain A
Confidence level:confident
Coverage over the Query: 117-397
View the alignment between query and template
View the model in PyMOL