BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 015343
(408 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3L4G|B Chain B, Crystal Structure Of Homo Sapiens Cytoplasmic
Phenylalanyl-T Synthetase
pdb|3L4G|D Chain D, Crystal Structure Of Homo Sapiens Cytoplasmic
Phenylalanyl-T Synthetase
pdb|3L4G|F Chain F, Crystal Structure Of Homo Sapiens Cytoplasmic
Phenylalanyl-T Synthetase
pdb|3L4G|H Chain H, Crystal Structure Of Homo Sapiens Cytoplasmic
Phenylalanyl-T Synthetase
pdb|3L4G|J Chain J, Crystal Structure Of Homo Sapiens Cytoplasmic
Phenylalanyl-T Synthetase
pdb|3L4G|L Chain L, Crystal Structure Of Homo Sapiens Cytoplasmic
Phenylalanyl-T Synthetase
pdb|3L4G|N Chain N, Crystal Structure Of Homo Sapiens Cytoplasmic
Phenylalanyl-T Synthetase
pdb|3L4G|P Chain P, Crystal Structure Of Homo Sapiens Cytoplasmic
Phenylalanyl-T Synthetase
Length = 589
Score = 34.3 bits (77), Expect = 0.13, Method: Compositional matrix adjust.
Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
Query: 310 FPKTYTKENIMPADKKEKFL--DSADSEFEKVIDFYLCSQSD 349
PKTYT N P +K + L D A + F + + F LCSQ D
Sbjct: 381 LPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQED 422
>pdb|2CSU|A Chain A, Crystal Structure Of Ph0766 From Pyrococcus Horikoshii Ot3
pdb|2CSU|B Chain B, Crystal Structure Of Ph0766 From Pyrococcus Horikoshii Ot3
Length = 457
Score = 29.6 bits (65), Expect = 3.0, Method: Compositional matrix adjust.
Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 5/54 (9%)
Query: 124 ERKFEDVYDVNKFIRSLDGV--VKVVKELPEEISFRNLAVVKVPNRVTEDHIIE 175
E K VY VN + GV K VK++P+EI +LA++ VP R +D +I+
Sbjct: 33 EYKKGKVYPVNIKEEEVQGVKAYKSVKDIPDEI---DLAIIVVPKRFVKDTLIQ 83
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.136 0.391
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,579,839
Number of Sequences: 62578
Number of extensions: 475738
Number of successful extensions: 1329
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1328
Number of HSP's gapped (non-prelim): 7
length of query: 408
length of database: 14,973,337
effective HSP length: 101
effective length of query: 307
effective length of database: 8,652,959
effective search space: 2656458413
effective search space used: 2656458413
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)