Citrus Sinensis ID: 015345

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41

MPELPEVEAARRAIEEHCIGKKIVKSIIADDNKVIDGVSASDFEASVLGKAILSAHRKGKNLWLRLDSPPFPSFQFGMTGAIYIKGVAVTQYKRSAVKDTDEWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLNDPTSVPPISELGPDALLEPMTVDEFTDSLSKKKITIKALLLDQSYISGIGNWVADEVLYQAKIHPLQTAVSLSKESCATLLKCIKEVIEKALEVGADSSQFPSNWIFHSREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLNGVQAAKAVGKPRKQAPKGEDSKDDDKYNSGDESESDGEEIAENVKSKKRQKLGGQVKQPSPRKRKSKESDTEDDDGGNDDDGGGSDDNAEEAPKTKSGKVTKNKQAKAVTTSKEKVISQKGKPSKKKAK

ccccHHHHHHHHHHHHHHcccEEEEEEEEccccccccccHHHHHHHHcccEEEEccccccEEEEEccccccEEEEcccccEEEEEEccccccccccccccccccccccEEEEEEccccEEEEcccccccEEEECccccccccccccccccccccccHHHHHHHHccccccHHHHHHccccEEccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEccccccccccccccccEEEEEcccccECccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccc

**ELPEVEAARRAIEEHCIGKKIVKSIIADDNKVIDGVSASDFEASVLGKAILSAHRKGKNLWLRLDSPPFPSFQFGMTGAIYIKGVAVTQYKRSAVKDTDEWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLNDPTSVPPISELGPDALLEPMTVDEFTDSLSKKKITIKALLLDQSYISGIGNWVADEVLYQAKIHPLQTAVSLSKESCATLLKCIKEVIEKALEVGADSSQFPSNWIFHSREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKL**********************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Formamidopyrimidine-DNA glycosylase	Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Can process efficiently 4,6-diamino-5-formamidopyrimidine (FapyA), 2,6-diamino-4- hydroxy-5-formamidopyrimidine (FapyG) and the further oxidation products of 8-oxoguanine (8-oxoG), such as guanidinohydantoin and spiroiminodihydantoin. Has marginal activity towards 8-oxoG. Has AP (apurinic/apyrimidinic) lyase activity. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.	confident	O80358

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TWL, chain A
Confidence level:very confident
Coverage over the Query: 2-85,103-286
View the alignment between query and template
View the model in PyMOL