BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015348
         (408 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex
          With Glutathione
 pdb|3FZA|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex
          With Glutathione And Beta-Mercaptoethanol
          Length = 112

 Score = 28.9 bits (63), Expect = 5.0,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 11 LNVDPSTLQLLQNSANLPMVGKPLYGVVSDAVYISGQHRVPYIAIGA 57
          LNVDP  ++L +  A  P + K L         ++GQH VP + IG 
Sbjct: 41 LNVDPLVVELDELGAQGPQIQKVLE-------RLTGQHTVPNVFIGG 80


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.135    0.390 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,429,244
Number of Sequences: 62578
Number of extensions: 319448
Number of successful extensions: 851
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 850
Number of HSP's gapped (non-prelim): 1
length of query: 408
length of database: 14,973,337
effective HSP length: 101
effective length of query: 307
effective length of database: 8,652,959
effective search space: 2656458413
effective search space used: 2656458413
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 53 (25.0 bits)