BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 015370
(408 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1WX2|A Chain A, Crystal Structure Of The Oxy-Form Of The Copper-Bound
Streptomyces Castaneoglobisporus Tyrosinase Complexed
With A Caddie Protein Prepared By The Addition Of
Hydrogenperoxide
pdb|1WX4|A Chain A, Crystal Structure Of The Oxy-Form Of The Copper-Bound
Streptomyces Castaneoglobisporus Tyrosinase Complexed
With A Caddie Protein Prepared By The Addition Of
Dithiothreitol
pdb|1WX5|A Chain A, Crystal Structure Of The Copper-Free Streptomyces
Castaneoglobisporus Tyrosinase Complexed With A Caddie
Protein In The Monoclinic Crystal
pdb|1WX5|C Chain C, Crystal Structure Of The Copper-Free Streptomyces
Castaneoglobisporus Tyrosinase Complexed With A Caddie
Protein In The Monoclinic Crystal
pdb|1WXC|A Chain A, Crystal Structure Of The Copper-Free Streptomyces
Castaneoglobisporus Tyrosinase Complexed With A Caddie
Protein
pdb|2AHK|A Chain A, Crystal Structure Of The Met-Form Of The Copper-Bound
Streptomyces Castaneoglobisporus Tyrosinase In Complex
With A Caddie Protein Obtained By Soking In Cupric
Sulfate For 6 Months
pdb|2AHL|A Chain A, Crystal Structure Of The Hydroxylamine-Induced Deoxy-Form
Of The Copper-Bound Streptomyces Castaneoglobisporus
Tyrosinase In Complex With A Caddie Protein
pdb|2ZMX|A Chain A, Crystal Structure Of The Met1-Form Of The Copper-Bound
Tyrosinase In Complex With A Caddie Protein From
Streptomyces Castaneoglobisporus Obtained By Soaking In
Cupric Sulfate Solution For 36 Hours
pdb|2ZMY|A Chain A, Crystal Structure Of The Met2-Form Of The Copper-Bound
Tyrosinase In Complex With A Caddie Protein From
Streptomyces Castaneoglobisporus Obtained By Soaking In
Cupric Sulfate Solution For 80 Hours
pdb|2ZMZ|A Chain A, The 1.37-A Crystal Structure Of The Hydroxylamine-Induced
Deoxy-Form Of The Copper-Bound Tyrosinase In Complex
With A Caddie Protein From Streptomyces
Castaneoglobisporus
pdb|2ZWD|A Chain A, Crystal Structure Of The Copper-Bound Tyrosinase In
Complex With A Caddie Protein From Streptomyces
Castaneoglobisporus Obtained By Soaking The Deoxy-Form
Crystal In Dioxygen- Saturated Solution For 5 Minutes
pdb|2ZWE|A Chain A, Crystal Structure Of The Copper-Bound Tyrosinase In
Complex With A Caddie Protein From Streptomyces
Castaneoglobisporus Obtained By Soaking The Deoxy-Form
Crystal In Dioxygen-Saturated Solution For 40 Minutes
pdb|2ZWF|A Chain A, Crystal Structure Of The Copper-Bound Tyrosinase In
Complex With A Caddie Protein From Streptomyces
Castaneoglobisporus Obtained By Soaking The Deoxy-Form
Crystal In Dioxygen-Saturated Solution For 80 Minutes
pdb|2ZWG|A Chain A, Crystal Structure Of The Copper-Bound Tyrosinase In
Complex With A Caddie Protein From Streptomyces
Castaneoglobisporus Obtained By Soaking The Deoxy-Form
Crystal In Dioxygen-Saturated Solution For 12 Hours
pdb|3AWS|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie Soaked In A Cu(Ii)-Containing Solution For
20 Hr: Occupancy Of Cu(Ii) Is Low
pdb|3AWT|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie Soaked In A Cu(Ii)-Containing Solution For
20 Hr: Occupancy Of Cu(Ii) Is High
pdb|3AWU|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie Soaked In A Cu(Ii)-Containing Solution For
40 H
pdb|3AWV|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie Soaked In A Cu(Ii)-Containing Solution For
80 Hr: Occupancy Of Cua Is Low
pdb|3AWW|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie Soaked In A Cu(Ii)-Containing Solution For
80 Hr: Occupancy Of Cua Is High
pdb|3AWX|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie H82q Mutant Soaked In A Cu(Ii)-Containing
Solution For 80 Hr
pdb|3AWY|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie M84l Mutant Soaked In A Cu(Ii)-Containing
Solution For 80 Hr
pdb|3AWZ|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie H97q Mutant Soaked In A Cu(Ii)-Containing
Solution For 80 Hr
pdb|3AX0|A Chain A, Crystal Structure Of Streptomyces Tyrosinase In A Complex
With Caddie Y98f Mutant Soaked In A Cu(Ii)-Containing
Solution For 80 Hr
Length = 281
Score = 30.8 bits (68), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 11/60 (18%)
Query: 84 NQATVS--ELRHILK---ELRKSQRYKHALEISEWMVTHKEFVLSDSDYATRIDLMTKVF 138
NQAT++ E R + EL++S RY E++ TH EF++SD+D R + F
Sbjct: 6 NQATLTADEKRRFVAAVLELKRSGRYD------EFVRTHNEFIMSDTDSGERTGHRSPSF 59
>pdb|3NTK|A Chain A, Crystal Structure Of Tudor
pdb|3NTK|B Chain B, Crystal Structure Of Tudor
Length = 169
Score = 30.0 bits (66), Expect = 2.8, Method: Compositional matrix adjust.
Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 7/87 (8%)
Query: 79 WVSEGNQATVSELRHILKELRKSQRYKHALEISEWMVTHKEFVLSDSDYATRID------ 132
++ GN A + R + +EL K RY E+ ++ + L S TR
Sbjct: 82 FIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISKCDAALLQSFIDTRFSETFQVE 141
Query: 133 -LMTKVFGIHSGERYFEGLPLSAKTSE 158
L TK G H +++ +S K E
Sbjct: 142 ILATKGTGTHVVRLFYQSKNISEKLQE 168
>pdb|3NTH|A Chain A, Crystal Structure Of Tudor And Aubergine [r13(Me2s)]
Complex
pdb|3NTI|A Chain A, Crystal Structure Of Tudor And Aubergine [r15(Me2s)]
Complex
Length = 172
Score = 29.6 bits (65), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 7/87 (8%)
Query: 79 WVSEGNQATVSELRHILKELRKSQRYKHALEISEWMVTHKEFVLSDSDYATRID------ 132
++ GN A + R + +EL K RY E+ ++ + L S TR
Sbjct: 84 FIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISKCDAALLQSFIDTRFSETFQVE 143
Query: 133 -LMTKVFGIHSGERYFEGLPLSAKTSE 158
L TK G H +++ +S K E
Sbjct: 144 ILATKGTGTHVVRLFYQSKNISEKLQE 170
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.131 0.380
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,339,735
Number of Sequences: 62578
Number of extensions: 431533
Number of successful extensions: 1255
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 1255
Number of HSP's gapped (non-prelim): 10
length of query: 408
length of database: 14,973,337
effective HSP length: 101
effective length of query: 307
effective length of database: 8,652,959
effective search space: 2656458413
effective search space used: 2656458413
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)