BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015381
         (408 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2VEQ|A Chain A, Insights Into Kinetochore-Dna Interactions From The
           Structure Of Cep3p
          Length = 565

 Score = 28.1 bits (61), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 11/67 (16%)

Query: 198 DIKVVDV--DKIASVDKNLGKLDGFDSLSDLELPPIITKPSKLDEEKKDSNEPTKYRRSS 255
           DIK++++  D++ S+ K LG L   + L          + S L+EE +++ EP+ +R   
Sbjct: 501 DIKIIELKNDEMFSLIKGLGSLVPLNKLR---------QESLLEEEDENNTEPSDFRTIV 551

Query: 256 VKFEDSH 262
            +F+  +
Sbjct: 552 EEFQSEY 558


>pdb|2QUQ|A Chain A, Crystal Structure Of The Essential Inner Kinetochore
           Protein Cep3p
          Length = 562

 Score = 28.1 bits (61), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 11/67 (16%)

Query: 198 DIKVVDV--DKIASVDKNLGKLDGFDSLSDLELPPIITKPSKLDEEKKDSNEPTKYRRSS 255
           DIK++++  D++ S+ K LG L   + L          + S L+EE +++ EP+ +R   
Sbjct: 498 DIKIIELKNDEMFSLIKGLGSLVPLNKLR---------QESLLEEEDENNTEPSDFRTIV 548

Query: 256 VKFEDSH 262
            +F+  +
Sbjct: 549 EEFQSEY 555


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.384 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,546,961
Number of Sequences: 62578
Number of extensions: 304944
Number of successful extensions: 554
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 554
Number of HSP's gapped (non-prelim): 4
length of query: 408
length of database: 14,973,337
effective HSP length: 101
effective length of query: 307
effective length of database: 8,652,959
effective search space: 2656458413
effective search space used: 2656458413
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)