BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 015381
(408 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2VEQ|A Chain A, Insights Into Kinetochore-Dna Interactions From The
Structure Of Cep3p
Length = 565
Score = 28.1 bits (61), Expect = 8.9, Method: Compositional matrix adjust.
Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 11/67 (16%)
Query: 198 DIKVVDV--DKIASVDKNLGKLDGFDSLSDLELPPIITKPSKLDEEKKDSNEPTKYRRSS 255
DIK++++ D++ S+ K LG L + L + S L+EE +++ EP+ +R
Sbjct: 501 DIKIIELKNDEMFSLIKGLGSLVPLNKLR---------QESLLEEEDENNTEPSDFRTIV 551
Query: 256 VKFEDSH 262
+F+ +
Sbjct: 552 EEFQSEY 558
>pdb|2QUQ|A Chain A, Crystal Structure Of The Essential Inner Kinetochore
Protein Cep3p
Length = 562
Score = 28.1 bits (61), Expect = 9.4, Method: Compositional matrix adjust.
Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 11/67 (16%)
Query: 198 DIKVVDV--DKIASVDKNLGKLDGFDSLSDLELPPIITKPSKLDEEKKDSNEPTKYRRSS 255
DIK++++ D++ S+ K LG L + L + S L+EE +++ EP+ +R
Sbjct: 498 DIKIIELKNDEMFSLIKGLGSLVPLNKLR---------QESLLEEEDENNTEPSDFRTIV 548
Query: 256 VKFEDSH 262
+F+ +
Sbjct: 549 EEFQSEY 555
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.130 0.384
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,546,961
Number of Sequences: 62578
Number of extensions: 304944
Number of successful extensions: 554
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 554
Number of HSP's gapped (non-prelim): 4
length of query: 408
length of database: 14,973,337
effective HSP length: 101
effective length of query: 307
effective length of database: 8,652,959
effective search space: 2656458413
effective search space used: 2656458413
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)