Citrus Sinensis ID: 015407

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------

MSLKSKGELTSRSVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFTRTTAMEAEKLKLVSEGCNPRLLQQKVVRHDSKDIFGEVFKTHNAIQTLDKTISNLEMELAAARAAQESILSGSPLSEDLKKTESSGKRRYLMVVGINTAFSSRKRRDSVRATWMLQGEKRKRLEEEKGIIMRFVIGHSATSGGILDRAIEAEDRKHGDFMRLDHVEGYLELSAKTKIYFATAVSLWDADFYVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF

ccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccccHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEcccccHHHHHHHHHcccccccccccccccccEEEEEEEEEccccccHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHcccCEEEEEcccccEEcHHHHHHHHHcccccccEEEEEccccccccccccccccccccccccccccccccccccEEEEcHHHHHHHHHHcccccccccccHHHHHHHHccccEEEcccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHcHHHHHHcccccc

*************VVSQKWTFLLCLGCFCAGMLFTNRMWAVP*S****************VSEGCNPRL*******HDSKDIFGEVFKTHNAIQTLDKTISNLEM*******************************RYLMVVGINTAFSSRKRRDSVRATWMLQGEKRKRLEEEKGIIMRFVIGHSATSGGILDRAIEAEDRKHGDFMRLDHVEGYLELSAKTKIYFATAVSLWDADFYVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF

xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSLKSKGELTSRSVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFTRTTAMEAEKLKLVSEGCNPRLLQQKVVRHDSKDIFGEVFKTHNAxxxxxxxxxxxxxxxxxxxxxQESILSGSPLSEDLKKTESSGKRRYLMVVGINTAFSSRKRRDSVRATWMLQGEKRKRLEEEKGIIMRFVIGHSATSGGILDRAIEAEDRKHGDFMRLDHVEGYLELSAKTKIYFATAVSLWDADFYVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable beta-1,3-galactosyltransferase 2	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	confident	A8MRC7
Probable beta-1,3-galactosyltransferase 4	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	probable	Q8LEJ9
Probable beta-1,3-galactosyltransferase 3	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	probable	Q9ZV71

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0A, chain A
Confidence level:confident
Coverage over the Query: 136-273,299-356
View the alignment between query and template
View the model in PyMOL