Citrus Sinensis ID: 015438

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------

MFVTASGVDFDEMGYAMSRFEIESEFYDAADTVNQASNSRSKFKKPLSALDHEIAQLTKLKSEPKEHFSKEVPGKRHLPVSTVKMLAGREGNYSGRGRFSAADCCHMLSRYLPVNGPWPVDQTTSRAYVSQFSADGSLFVAGFQASQIRIYDVERGWKIQKDILAKSLRWTVTDTSLSPDQRHLVYASMSPIVHIVDVGSGTMESLANVTEIHDGLDFSAADDGGYSFGIFSLKFSTDGRELVAGSSDDCIYVYDLEANKLSLRILAHTSDVNTVCFGDESGHLIYSGSDDNLCKVWDRRCLNVKGKPAGVLMGHLEGITFIDSRGDGRYLISNGKDQAIKLWDIRKMSSNASCNLGFRSYEWDYRWMDYPPQARDLKHPCDQSVATYKGHSVLRTLIRCHFSPVYR

ccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEECcccccEECccccccEEEECccccccEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEccccccCEEEEEEcccccEEEEECccccEEEEEcccccEEEEcccccccccccccccccccccccEEEEEEcccccEEEEECcccEEEEEEccccEEEEEEccccccEEEEEECcccccEEEEECcccEEEEEEccccccccCEEEEcccccccEEEEEEcccccEEEECcccccEEEccccccccccccccccccccccEEEEEEccccccccccccccEEEEEcccccccEEEEEEccccc

*******VDFDEMGYAMSRFEIESEFY********************************************VPGKRHLPVSTVKMLAGREGNYSGRGRFSAADCCHMLSRYLPVNGPWPVDQTTSRAYVSQFSADGSLFVAGFQASQIRIYDVERGWKIQKDILAKSLRWTVTDTSLSPDQRHLVYASMSPIVHIVDVGSGTMESLANVTEIHDGLDFSAADDGGYSFGIFSLKFSTDGRELVAGSSDDCIYVYDLEANKLSLRILAHTSDVNTVCFGDESGHLIYSGSDDNLCKVWDRRCLNVKGKPAGVLMGHLEGITFIDSRGDGRYLISNGKDQAIKLWDIRKMSSNASCNLGFRSYEWDYRWMDYPPQARDLKHPCDQSVATYKGHSVLRTLIRCHFSPVYR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
LEC14B protein		probable	Q40153
LEC14B homolog		probable	O24467

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 118-208,225-389
View the alignment between query and template
View the model in PyMOL

Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 102-208,225-407
View the alignment between query and template
View the model in PyMOL

Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 102-407
View the alignment between query and template
View the model in PyMOL

Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 81-208,225-389
View the alignment between query and template
View the model in PyMOL