Citrus Sinensis ID: 015453
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 406 | ||||||
| 255583646 | 395 | trehalose-6-phosphate synthase, putative | 0.935 | 0.962 | 0.821 | 0.0 | |
| 359496005 | 393 | PREDICTED: trehalose-phosphate phosphata | 0.950 | 0.982 | 0.809 | 0.0 | |
| 359474381 | 393 | PREDICTED: trehalose-phosphate phosphata | 0.950 | 0.982 | 0.809 | 0.0 | |
| 298204834 | 383 | unnamed protein product [Vitis vinifera] | 0.931 | 0.986 | 0.792 | 1e-177 | |
| 297741156 | 406 | unnamed protein product [Vitis vinifera] | 0.931 | 0.931 | 0.792 | 1e-176 | |
| 449465872 | 399 | PREDICTED: probable trehalose-phosphate | 0.926 | 0.942 | 0.783 | 1e-169 | |
| 449520411 | 401 | PREDICTED: probable trehalose-phosphate | 0.926 | 0.937 | 0.783 | 1e-169 | |
| 147771549 | 385 | hypothetical protein VITISV_039552 [Viti | 0.933 | 0.984 | 0.761 | 1e-168 | |
| 255539761 | 386 | trehalose-6-phosphate synthase, putative | 0.933 | 0.981 | 0.735 | 1e-162 | |
| 359490201 | 373 | PREDICTED: uncharacterized glycosyl hydr | 0.906 | 0.986 | 0.742 | 1e-162 |
| >gi|255583646|ref|XP_002532578.1| trehalose-6-phosphate synthase, putative [Ricinus communis] gi|223527705|gb|EEF29812.1| trehalose-6-phosphate synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 651 bits (1680), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 314/382 (82%), Positives = 349/382 (91%), Gaps = 2/382 (0%)
Query: 1 MELKSNQASPVLTDPASLNKSKLGIHSRL-PYSQPGASF-SGKCIAIPRKKPGKLDDVRS 58
M++KS SPVLTDPA +NKS+LGIHS L YSQ GAS+ SGK I IPRKKPGKLDDVRS
Sbjct: 1 MDIKSTNPSPVLTDPAPINKSRLGIHSNLLAYSQSGASYASGKHINIPRKKPGKLDDVRS 60
Query: 59 NGWLDAMKSSSPPRKKLIKDFNADVGLDDFDIAYCSWMLKYPSALKYFEKIMSEAKKKKI 118
NGWLDAMKSSSPPRKKLIK+F+ +V D+ DIAY SWMLKYPSAL FE+I + AK KKI
Sbjct: 61 NGWLDAMKSSSPPRKKLIKNFSIEVASDETDIAYFSWMLKYPSALNSFEQITNFAKNKKI 120
Query: 119 AIFSDYDGTLSPIVDDPDRAIMSDGMRSAVRNVAKYFPTAIITGRSRDKVYELVGLTELY 178
A+F DYDGTLSPIVDDPD+A+MSD MRSAVRNVAKYFPTAII+GRSRDKV+ELVGLTELY
Sbjct: 121 AMFLDYDGTLSPIVDDPDQALMSDDMRSAVRNVAKYFPTAIISGRSRDKVFELVGLTELY 180
Query: 179 YAGSHGMDIMGPVDHTVSDDHPNSIKSTDQQGKEVNLFQPAREFLPMIDEVFRTLVENTK 238
YAGSHGMDIMGP++++VS+DH N IKSTDQQGK+VNLFQPA+EF+ MIDEVFRTLVENTK
Sbjct: 181 YAGSHGMDIMGPINNSVSNDHANGIKSTDQQGKDVNLFQPAKEFISMIDEVFRTLVENTK 240
Query: 239 SIKGAKVENHKFCVSVHYRNVDEKSWPTIAQCVHDVLKDYPRLRLTHGRKVLEIRPVIDW 298
+IKGAKVENHKFC SVHYRNVDEK+WPT+AQ VHD+LK YPRLRLTHGRKVLE+RPVIDW
Sbjct: 241 AIKGAKVENHKFCTSVHYRNVDEKNWPTVAQIVHDILKQYPRLRLTHGRKVLEVRPVIDW 300
Query: 299 NKGKAVEFLLESLGLSDSDDVLPIYIGDDRTDEDAFKVLRKGNRGYGILVSSVPKETKAF 358
NKGKAVEFLLESLGLS+SDDVLPI+IGDDRTDEDAFKVLRKGN+GYGILVS VPKET AF
Sbjct: 301 NKGKAVEFLLESLGLSNSDDVLPIFIGDDRTDEDAFKVLRKGNKGYGILVSPVPKETNAF 360
Query: 359 YSLRDPSEVQEFLLSLVRWKKL 380
YSLRDP+EV +FL SLVRWK+L
Sbjct: 361 YSLRDPTEVMKFLKSLVRWKQL 382
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359496005|ref|XP_002264471.2| PREDICTED: trehalose-phosphate phosphatase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359474381|ref|XP_003631447.1| PREDICTED: trehalose-phosphate phosphatase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|298204834|emb|CBI25779.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297741156|emb|CBI31887.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449465872|ref|XP_004150651.1| PREDICTED: probable trehalose-phosphate phosphatase G-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449520411|ref|XP_004167227.1| PREDICTED: probable trehalose-phosphate phosphatase G-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147771549|emb|CAN71555.1| hypothetical protein VITISV_039552 [Vitis vinifera] gi|296084198|emb|CBI24586.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255539761|ref|XP_002510945.1| trehalose-6-phosphate synthase, putative [Ricinus communis] gi|223550060|gb|EEF51547.1| trehalose-6-phosphate synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359490201|ref|XP_002265679.2| PREDICTED: uncharacterized glycosyl hydrolase Rv2006/MT2062 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 406 | ||||||
| TAIR|locus:2127510 | 377 | TPPG "trehalose-6-phosphate ph | 0.911 | 0.981 | 0.678 | 1.1e-135 | |
| TAIR|locus:2135540 | 368 | TPPF "trehalose-6-phosphate ph | 0.807 | 0.891 | 0.761 | 1.6e-134 | |
| TAIR|locus:2153082 | 385 | ATTPPA [Arabidopsis thaliana ( | 0.923 | 0.974 | 0.637 | 1.3e-125 | |
| UNIPROTKB|Q9FWQ2 | 382 | TPP2 "Probable trehalose-phosp | 0.918 | 0.976 | 0.584 | 1.4e-112 | |
| UNIPROTKB|Q75WV3 | 371 | TPP1 "Probable trehalose-phosp | 0.896 | 0.981 | 0.592 | 1.5e-108 | |
| TAIR|locus:2007651 | 369 | TPPD "trehalose-6-phosphate ph | 0.857 | 0.943 | 0.530 | 3.5e-91 | |
| TAIR|locus:2184063 | 369 | TPPI "trehalose-6-phosphate ph | 0.795 | 0.875 | 0.521 | 4.7e-87 | |
| TAIR|locus:2135272 | 349 | TPPH "trehalose-6-phosphate ph | 0.687 | 0.799 | 0.588 | 1.3e-84 | |
| TAIR|locus:2194704 | 374 | TPPB "trehalose-6-phosphate ph | 0.743 | 0.807 | 0.537 | 3.4e-84 | |
| TAIR|locus:2171850 | 370 | TPPJ "trehalose-6-phosphate ph | 0.687 | 0.754 | 0.574 | 5e-83 |
| TAIR|locus:2127510 TPPG "trehalose-6-phosphate phosphatase G" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1329 (472.9 bits), Expect = 1.1e-135, P = 1.1e-135
Identities = 259/382 (67%), Positives = 309/382 (80%)
Query: 1 MELKSNQASPVLTDPAS-LNKSKLGIHSRLPYSQPGASFSGKCIAIPRKKPGKLDDVRSN 59
M+L N+ +PVL+DP + ++K++LG S P SG+ + RKK KLDDVRSN
Sbjct: 1 MDLNINKTTPVLSDPTTPVSKTRLG--SSFP--------SGRFMMNSRKKIPKLDDVRSN 50
Query: 60 GWLDAMKSSSPPRKKLIKDFNADVGLDDFDIAYCSWMLKYPSALKYFEKIMSEAKKKKIA 119
GWLDAM SSSPPRK+L+KDFN ++ +D D + +WMLKYPSA+ F I ++AK KKIA
Sbjct: 51 GWLDAMISSSPPRKRLVKDFNIEIAPED-DFSQRAWMLKYPSAITSFAHIAAQAKNKKIA 109
Query: 120 IFSDYDGTLSPIVDDPDRAIMSDGMRSAVRNVAKYFPTAIITGRSRDKVYELVGLTELYY 179
+F DYDGTLSPIVDDPDRAIMSD MR+AV++VAKYFPTAII+GRSRDKVY+LVGLTELYY
Sbjct: 110 VFLDYDGTLSPIVDDPDRAIMSDAMRAAVKDVAKYFPTAIISGRSRDKVYQLVGLTELYY 169
Query: 180 AGSHGMDIMGPVDHTVSDDHPNSIKSTDQQGKEVNLFQPAREFLPMIDEVFRTLVENTKS 239
AGSHGMDIM PV+ S + PN IK+TDQQG+EVNLFQPA+EF+P+I+EV+ LVE TK
Sbjct: 170 AGSHGMDIMTPVNPNGSPEDPNCIKTTDQQGEEVNLFQPAKEFIPVIEEVYNNLVEITKC 229
Query: 240 IKGAKVENHKFCVSVHYRNVDEKSWPTIAQCVHDVLKDYPRLRLTHGRKVLEIRPVIDWN 299
IKGAKVENHKFC SVHYRNVDEK WP +AQ VHD LK YPRLR+THGRKVLE+RPVI+WN
Sbjct: 230 IKGAKVENHKFCTSVHYRNVDEKDWPLVAQRVHDHLKRYPRLRITHGRKVLEVRPVIEWN 289
Query: 300 KGKAVEFXXXXXXXXXXXXXXPIYIGDDRTDEDAFKVLRKGNRGYGILVSSVPKETKAFY 359
KGKAVEF PI+IGDD+TDEDAFKVLR+GNRG+GILVSSVPKE+ AFY
Sbjct: 290 KGKAVEFLLESLGLSNNDEFLPIFIGDDKTDEDAFKVLREGNRGFGILVSSVPKESNAFY 349
Query: 360 SLRDPSEVQEFLLSLVRWKKLE 381
SLRDPSEV++FL +LV+W K+E
Sbjct: 350 SLRDPSEVKKFLKTLVKWGKME 371
|
|
| TAIR|locus:2135540 TPPF "trehalose-6-phosphate phosphatase F" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153082 ATTPPA [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9FWQ2 TPP2 "Probable trehalose-phosphate phosphatase 2" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q75WV3 TPP1 "Probable trehalose-phosphate phosphatase 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2007651 TPPD "trehalose-6-phosphate phosphatase D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184063 TPPI "trehalose-6-phosphate phosphatase I" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135272 TPPH "trehalose-6-phosphate phosphatase H" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2194704 TPPB "trehalose-6-phosphate phosphatase B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171850 TPPJ "trehalose-6-phosphate phosphatase J" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00007296001 | SubName- Full=Chromosome chr2 scaffold_187, whole genome shotgun sequence; (383 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00007211001 | • | • | • | • | 0.567 | ||||||
| GSVIVG00017367001 | • | 0.490 | |||||||||
| GSVIVG00036481001 | • | 0.489 | |||||||||
| GSVIVG00027920001 | • | 0.487 | |||||||||
| GSVIVG00007213001 | • | 0.455 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 406 | |||
| PLN02580 | 384 | PLN02580, PLN02580, trehalose-phosphatase | 0.0 | |
| PLN03017 | 366 | PLN03017, PLN03017, trehalose-phosphatase | 1e-132 | |
| PLN02151 | 354 | PLN02151, PLN02151, trehalose-phosphatase | 1e-129 | |
| pfam02358 | 235 | pfam02358, Trehalose_PPase, Trehalose-phosphatase | 9e-76 | |
| TIGR00685 | 244 | TIGR00685, T6PP, trehalose-phosphatase | 3e-43 | |
| COG1877 | 266 | COG1877, OtsB, Trehalose-6-phosphatase [Carbohydra | 1e-37 | |
| PRK14501 | 726 | PRK14501, PRK14501, putative bifunctional trehalos | 2e-32 | |
| PRK10187 | 266 | PRK10187, PRK10187, trehalose-6-phosphate phosphat | 2e-15 | |
| TIGR01484 | 204 | TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, | 4e-13 | |
| TIGR01482 | 225 | TIGR01482, SPP-subfamily, sucrose-phosphate phosph | 5e-06 | |
| COG0561 | 264 | COG0561, Cof, Predicted hydrolases of the HAD supe | 8e-06 | |
| PLN02205 | 854 | PLN02205, PLN02205, alpha,alpha-trehalose-phosphat | 6e-05 | |
| PRK01158 | 230 | PRK01158, PRK01158, phosphoglycolate phosphatase; | 9e-05 | |
| TIGR01487 | 215 | TIGR01487, Pglycolate_arch, phosphoglycolate phosp | 1e-04 |
| >gnl|CDD|215317 PLN02580, PLN02580, trehalose-phosphatase | Back alignment and domain information |
|---|
Score = 748 bits (1932), Expect = 0.0
Identities = 318/384 (82%), Positives = 342/384 (89%), Gaps = 2/384 (0%)
Query: 1 MELKSNQASPVLTDPASLNKSKLGIHS-RLPYSQPGASF-SGKCIAIPRKKPGKLDDVRS 58
M+LKSN +SPVLTDPA +NKS+LGI S LPYS GASF S + IPRKK GKLDDVRS
Sbjct: 1 MDLKSNHSSPVLTDPAPINKSRLGIRSNLLPYSSAGASFSSNLFLTIPRKKTGKLDDVRS 60
Query: 59 NGWLDAMKSSSPPRKKLIKDFNADVGLDDFDIAYCSWMLKYPSALKYFEKIMSEAKKKKI 118
NGWLDAMKSSSPPRKKL KDFN ++ D D AY +WMLKYPSAL FE+I + AK KKI
Sbjct: 61 NGWLDAMKSSSPPRKKLNKDFNVELASPDTDFAYRTWMLKYPSALTSFEQIANFAKGKKI 120
Query: 119 AIFSDYDGTLSPIVDDPDRAIMSDGMRSAVRNVAKYFPTAIITGRSRDKVYELVGLTELY 178
A+F DYDGTLSPIVDDPDRA+MSD MRSAV+NVAKYFPTAII+GRSRDKVYELVGLTELY
Sbjct: 121 ALFLDYDGTLSPIVDDPDRALMSDAMRSAVKNVAKYFPTAIISGRSRDKVYELVGLTELY 180
Query: 179 YAGSHGMDIMGPVDHTVSDDHPNSIKSTDQQGKEVNLFQPAREFLPMIDEVFRTLVENTK 238
YAGSHGMDIMGPV +VS+DHPN IKSTDQQGKEVNLFQPA EFLPMIDEVFR+LVE+TK
Sbjct: 181 YAGSHGMDIMGPVRESVSNDHPNCIKSTDQQGKEVNLFQPASEFLPMIDEVFRSLVESTK 240
Query: 239 SIKGAKVENHKFCVSVHYRNVDEKSWPTIAQCVHDVLKDYPRLRLTHGRKVLEIRPVIDW 298
IKGAKVENHKFCVSVHYRNVDEK+WP +AQCVHDVLK YPRLRLTHGRKVLE+RPVIDW
Sbjct: 241 DIKGAKVENHKFCVSVHYRNVDEKNWPLVAQCVHDVLKKYPRLRLTHGRKVLEVRPVIDW 300
Query: 299 NKGKAVEFLLESLGLSDSDDVLPIYIGDDRTDEDAFKVLRKGNRGYGILVSSVPKETKAF 358
NKGKAVEFLLESLGLS+ DDVLPIYIGDDRTDEDAFKVLR+GNRGYGILVSSVPKE+ AF
Sbjct: 301 NKGKAVEFLLESLGLSNCDDVLPIYIGDDRTDEDAFKVLREGNRGYGILVSSVPKESNAF 360
Query: 359 YSLRDPSEVQEFLLSLVRWKKLEK 382
YSLRDPSEV EFL SLV WKK E
Sbjct: 361 YSLRDPSEVMEFLKSLVTWKKSEA 384
|
Length = 384 |
| >gnl|CDD|178591 PLN03017, PLN03017, trehalose-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|177812 PLN02151, PLN02151, trehalose-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|216992 pfam02358, Trehalose_PPase, Trehalose-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|233092 TIGR00685, T6PP, trehalose-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|224789 COG1877, OtsB, Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184712 PRK14501, PRK14501, putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182291 PRK10187, PRK10187, trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233434 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >gnl|CDD|233433 TIGR01482, SPP-subfamily, sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223635 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|177855 PLN02205, PLN02205, alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >gnl|CDD|234910 PRK01158, PRK01158, phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213628 TIGR01487, Pglycolate_arch, phosphoglycolate phosphatase, TA0175-type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 406 | |||
| PLN02580 | 384 | trehalose-phosphatase | 100.0 | |
| PLN03017 | 366 | trehalose-phosphatase | 100.0 | |
| PLN02151 | 354 | trehalose-phosphatase | 100.0 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 100.0 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 100.0 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 100.0 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 100.0 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 100.0 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 100.0 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 100.0 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 100.0 | |
| KOG1050 | 732 | consensus Trehalose-6-phosphate synthase component | 100.0 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 99.97 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 99.97 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.96 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.96 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 99.96 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.96 | |
| PLN02887 | 580 | hydrolase family protein | 99.95 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 99.95 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 99.94 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 99.94 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 99.94 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 99.94 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.94 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 99.94 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 99.94 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 99.93 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.92 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.91 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 99.91 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 99.9 | |
| PLN02423 | 245 | phosphomannomutase | 99.9 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 99.88 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 99.86 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 99.85 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.82 | |
| KOG1050 | 732 | consensus Trehalose-6-phosphate synthase component | 99.79 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 99.58 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 99.39 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 99.2 | |
| PF03332 | 220 | PMM: Eukaryotic phosphomannomutase; InterPro: IPR0 | 99.15 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.09 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.0 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 98.96 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 98.82 | |
| PRK10117 | 474 | trehalose-6-phosphate synthase; Provisional | 98.6 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 98.59 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.48 | |
| COG0380 | 486 | OtsA Trehalose-6-phosphate synthase [Carbohydrate | 98.4 | |
| TIGR02398 | 487 | gluc_glyc_Psyn glucosylglycerol-phosphate synthase | 98.38 | |
| PF00982 | 474 | Glyco_transf_20: Glycosyltransferase family 20; In | 98.37 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 98.32 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 98.16 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.13 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 98.07 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 98.06 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 97.81 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 97.25 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 97.24 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.18 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.13 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 97.08 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 97.05 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.01 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 96.9 | |
| TIGR02400 | 456 | trehalose_OtsA alpha,alpha-trehalose-phosphate syn | 96.87 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 96.82 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 96.81 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 96.48 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 96.47 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 96.32 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 96.17 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 96.14 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 96.11 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 96.07 | |
| PF06437 | 408 | ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 | 96.06 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 96.02 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 95.99 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 95.98 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 95.96 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 95.9 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 95.89 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 95.82 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 95.81 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 95.76 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 95.76 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 95.75 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 95.71 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 95.68 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 95.62 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 95.52 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 95.48 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 95.47 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 95.46 | |
| PLN02954 | 224 | phosphoserine phosphatase | 95.45 | |
| PRK06769 | 173 | hypothetical protein; Validated | 95.44 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 95.4 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 95.31 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 95.27 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 95.21 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 95.19 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 95.1 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 95.05 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 95.03 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 95.01 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 94.96 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 94.92 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 94.85 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 94.83 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 94.74 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 94.6 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 94.58 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 94.5 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 94.47 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 94.46 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 94.45 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 94.45 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 94.44 | |
| cd03788 | 460 | GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a | 94.38 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 94.29 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 94.26 | |
| PLN02954 | 224 | phosphoserine phosphatase | 94.24 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 94.14 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 94.12 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 93.98 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 93.9 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 93.83 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 93.47 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 93.3 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 93.27 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 93.24 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 93.03 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 92.94 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 92.72 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 92.7 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 92.68 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 92.63 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 92.62 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 92.53 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 92.49 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 92.48 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 92.41 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 92.39 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 92.27 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 92.2 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 92.17 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 92.13 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 92.03 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 91.82 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 91.59 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 91.58 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 91.53 | |
| PRK08238 | 479 | hypothetical protein; Validated | 91.51 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 91.41 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 91.24 | |
| PRK06769 | 173 | hypothetical protein; Validated | 90.69 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 90.69 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 90.59 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 90.31 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 90.2 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 90.12 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 90.07 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 89.95 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 89.8 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 89.66 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 89.14 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 89.09 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 88.96 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 88.56 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 88.47 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 88.31 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 88.25 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 88.13 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 87.98 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 87.44 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 87.36 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 87.25 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 87.22 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 86.98 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 86.91 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 86.86 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 86.59 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 86.4 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 86.34 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 86.15 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 85.94 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 85.54 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 85.37 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 85.33 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 85.25 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 84.6 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 84.38 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 84.24 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 83.8 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 83.74 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 83.12 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 83.0 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 82.76 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 82.76 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 82.71 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 82.66 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 82.06 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 81.86 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 81.85 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 81.49 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 81.37 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 81.28 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 81.22 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 81.2 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 81.02 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 80.85 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 80.8 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 80.78 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 80.68 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 80.14 |
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-83 Score=638.10 Aligned_cols=381 Identities=83% Similarity=1.291 Sum_probs=347.3
Q ss_pred CCCCCCCCCCcccCCcccccccccccCC-CccCCCCCCCC-CceeecCCCCCCCcchhhhccHHHHHhcCCchhhhhccc
Q 015453 1 MELKSNQASPVLTDPASLNKSKLGIHSR-LPYSQPGASFS-GKCIAIPRKKPGKLDDVRSNGWLDAMKSSSPPRKKLIKD 78 (406)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~s~~~~~~~-g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 78 (406)
|||||||+|||||||+|++++|+|++++ |+||..+++|+ |.++.+||||++.+|++++++|+|+|+++||++++..++
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (384)
T PLN02580 1 MDLKSNHSSPVLTDPAPINKSRLGIRSNLLPYSSAGASFSSNLFLTIPRKKTGKLDDVRSNGWLDAMKSSSPPRKKLNKD 80 (384)
T ss_pred CCcccCCCCcccCCCccccccccccccccccccCCcCcCCCCceeeccccCCCccccccccchhhhhhccCCCccccccc
Confidence 9999999999999999999999999999 99999999985 999999999999999999999999999999999876666
Q ss_pred cCCCCCcccchhhhhhHHhhCCccchhHHHHHHHhccCCEEEEEecCCccCCCCCCCCccCCChhHHHHHHHHHhcCCEE
Q 015453 79 FNADVGLDDFDIAYCSWMLKYPSALKYFEKIMSEAKKKKIAIFSDYDGTLSPIVDDPDRAIMSDGMRSAVRNVAKYFPTA 158 (406)
Q Consensus 79 ~~~~~~~~~~~~~~~~w~~~~p~~L~~f~~i~~~~~~k~~lI~lD~DGTL~~~~~~p~~~~~s~~~~~aL~~L~~~~~v~ 158 (406)
++..+.+...+.+|.+|+.+|||||.+|++|.+|+++++++|||||||||+|++++|+.+.++++++++|++|+++++|+
T Consensus 81 ~~~~~~~~~~~~~~~~~~~~~p~al~~~~~~~~~~~~k~~~LfLDyDGTLaPIv~~Pd~A~~s~~~~~aL~~La~~~~VA 160 (384)
T PLN02580 81 FNVELASPDTDFAYRTWMLKYPSALTSFEQIANFAKGKKIALFLDYDGTLSPIVDDPDRALMSDAMRSAVKNVAKYFPTA 160 (384)
T ss_pred cccccccccchHHHHHHHHhCcHHHHHHHHHHHHhhcCCeEEEEecCCccCCCCCCcccccCCHHHHHHHHHHhhCCCEE
Confidence 55555566778899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEcCCChhhHHHHhCCcCceEEccCCceEeCCCCCcccCCCCCCcccccccCCccccccccccccchHHHHHHHHHHHhh
Q 015453 159 IITGRSRDKVYELVGLTELYYAGSHGMDIMGPVDHTVSDDHPNSIKSTDQQGKEVNLFQPAREFLPMIDEVFRTLVENTK 238 (406)
Q Consensus 159 I~SGR~~~~l~~~~~l~~~~li~~nGa~I~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~~~i~~v~~~l~~~~~ 238 (406)
|+|||+++.+.+++++++++|+|+||++++.+.+......|..+++..+..|++..+++++.+|+++++++++.+.++++
T Consensus 161 IVSGR~~~~L~~~l~~~~l~laGsHG~e~~~p~~~~~~~~~~~~~~~~~~~g~~~~~~~~a~~~~~~i~~v~~~l~e~~~ 240 (384)
T PLN02580 161 IISGRSRDKVYELVGLTELYYAGSHGMDIMGPVRESVSNDHPNCIKSTDQQGKEVNLFQPASEFLPMIDEVFRSLVESTK 240 (384)
T ss_pred EEeCCCHHHHHHHhCCCCccEEEeCCceeecCCCCcccccccccccccccccccccccccchhhhhhHHHHHHHHHHHhc
Confidence 99999999999999998999999999999987654433457666655555565555778888899999999999998889
Q ss_pred hccCceeeecceeEEEEeeecCCCCHHHHHHHHHHHHhhCCCeEEEecCeEEEEEcCCCCCHHHHHHHHHHHcCCCCCCC
Q 015453 239 SIKGAKVENHKFCVSVHYRNVDEKSWPTIAQCVHDVLKDYPRLRLTHGRKVLEIRPVIDWNKGKAVEFLLESLGLSDSDD 318 (406)
Q Consensus 239 ~~~g~~vE~~~~~l~~h~r~~d~~~~~~l~~~l~~~l~~~p~l~v~~g~~~lEI~P~~gvsKG~Al~~Ll~~lg~~~~~~ 318 (406)
++||++||+|++|++||||+++++.++.+.+.+..+++++|+++++.|++++||+|.++||||.|+++|++.+|++..+.
T Consensus 241 ~~pGs~VE~K~~svavHYR~a~~~~~~~~~~~l~~~l~~~~~l~v~~Gk~vlEVrP~~g~~KG~Av~~Ll~~~g~~~~d~ 320 (384)
T PLN02580 241 DIKGAKVENHKFCVSVHYRNVDEKNWPLVAQCVHDVLKKYPRLRLTHGRKVLEVRPVIDWNKGKAVEFLLESLGLSNCDD 320 (384)
T ss_pred cCCCCEEEecCcEEEEEeCCCCchHHHHHHHHHHHHHHhCCceEEEeCCeEEEEecCCCCCHHHHHHHHHHhcCCCcccc
Confidence 99999999999999999999988878888888888888888899999999999999339999999999999999886543
Q ss_pred ccEEEEeCCcCCHHHHHHHHhCCCceEEEecCCCCCccceEEeCCHHHHHHHHHHHHHhhhhh
Q 015453 319 VLPIYIGDDRTDEDAFKVLRKGNRGYGILVSSVPKETKAFYSLRDPSEVQEFLLSLVRWKKLE 381 (406)
Q Consensus 319 ~~viaiGD~~NDedMf~~~~~~~~G~gVaVgna~~~t~A~y~l~~~~eV~~fL~~L~~~~~~~ 381 (406)
..++||||+.|||+||++++..++|+||+|+|+++++.|+|+|+++++|.+||+.|+.|++.+
T Consensus 321 ~~pi~iGDD~TDedmF~~L~~~~~G~~I~Vgn~~~~t~A~y~L~dp~eV~~~L~~L~~~~~~~ 383 (384)
T PLN02580 321 VLPIYIGDDRTDEDAFKVLREGNRGYGILVSSVPKESNAFYSLRDPSEVMEFLKSLVTWKKSE 383 (384)
T ss_pred eeEEEECCCchHHHHHHhhhccCCceEEEEecCCCCccceEEcCCHHHHHHHHHHHHHhhhcC
Confidence 457999999999999999987667999999999999999999999999999999999999764
|
|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >PF03332 PMM: Eukaryotic phosphomannomutase; InterPro: IPR005002 This enzyme (5 | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK10117 trehalose-6-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase | Back alignment and domain information |
|---|
| >PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 406 | ||||
| 1u02_A | 239 | Crystal Structure Of Trehalose-6-Phosphate Phosphat | 4e-07 |
| >pdb|1U02|A Chain A, Crystal Structure Of Trehalose-6-Phosphate Phosphatase Related Protein Length = 239 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 406 | |||
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 4e-85 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 2e-11 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 2e-09 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 3e-09 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 8e-07 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 4e-06 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 1e-05 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 4e-05 |
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Length = 239 | Back alignment and structure |
|---|
Score = 258 bits (661), Expect = 4e-85
Identities = 54/258 (20%), Positives = 101/258 (39%), Gaps = 36/258 (13%)
Query: 119 AIFSDYDGTLSPIVDDPDRAIMSDGMRSAVRNVAKYFPTAIITGRSRDKVYELVGLTELY 178
IF DYDGTL PI+ +P+ + G+ S + ++ + F T I+TGRS +++ + L ++
Sbjct: 3 LIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPL-DIN 61
Query: 179 YAGSHGMDIMGPVDHTVSDDHPNSIKSTDQQGKEVNLFQPAREFLPMIDEVFRTLVENTK 238
HG ++ + FL + D ++
Sbjct: 62 MICYHGACSKIN--------------------GQIVYNNGSDRFLGVFDRIYEDTRSWVS 101
Query: 239 SIKGAKVENHKFCVSVHYRNVDEKSWPTIAQCVHDVLKDYPRLRLTHGRKVLEIRPVIDW 298
G ++ V H + P + + ++ + + + +G+ ++E+R
Sbjct: 102 DFPGLRIYRKNLAVLYHLGLMGADMKPKLRSRIEEIARIFG-VETYYGKMIIELRV-PGV 159
Query: 299 NKGKAVEFLLESLGLSDSDDVLPIYIGDDRTDEDAFKVLRKGNRGYGILVSSVPKETKAF 358
NKG A+ + + I GDD TDE AF+ I V ET A
Sbjct: 160 NKGSAIRSVR--------GERPAIIAGDDATDEAAFEANDD---ALTIKVG--EGETHAK 206
Query: 359 YSLRDPSEVQEFLLSLVR 376
+ + D E+++ L +
Sbjct: 207 FHVADYIEMRKILKFIEM 224
|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Length = 246 | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Length = 262 | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Length = 332 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Length = 275 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Length = 289 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Length = 259 | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} PDB: 2i54_A* 2i55_A* Length = 246 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Length = 249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 406 | |||
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 100.0 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 99.96 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 99.96 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 99.95 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 99.95 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 99.95 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 99.95 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 99.94 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 99.94 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 99.94 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 99.94 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 99.94 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 99.94 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 99.94 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 99.94 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 99.93 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 99.93 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.93 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 99.93 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 99.93 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 99.92 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.92 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 99.92 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 99.92 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.91 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.86 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.53 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 99.48 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.47 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 99.44 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.43 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.38 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 99.35 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.35 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.34 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.28 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.26 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.24 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.22 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.22 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.2 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.2 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 99.09 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.06 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.03 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.03 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 98.98 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 98.94 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 98.94 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.93 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 98.91 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 98.88 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 98.86 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 98.84 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 98.77 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 98.77 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 98.76 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 98.76 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 98.71 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 98.67 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 98.61 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 98.52 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 98.5 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.46 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 98.45 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 98.44 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 98.39 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 98.35 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 98.35 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 98.33 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 98.31 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.3 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 98.28 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 98.28 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 98.27 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 98.21 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 98.2 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 98.14 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 98.14 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 98.13 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 98.12 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 98.08 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 98.03 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.03 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 98.0 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 97.99 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 97.97 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 97.94 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.92 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 97.91 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 97.89 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 97.86 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 97.85 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 97.83 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 97.79 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 97.79 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 97.75 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 97.75 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 97.72 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 97.71 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 97.61 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 97.56 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 97.48 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 97.48 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 97.43 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 97.41 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.38 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 97.36 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 97.31 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 97.31 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 97.29 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 97.28 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 97.22 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 97.18 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 97.17 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 97.11 | |
| 3t5t_A | 496 | Putative glycosyltransferase; GTB fold, pseudoglyc | 97.05 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 96.97 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 96.9 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 96.84 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 96.79 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 96.73 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 96.66 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 96.55 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 96.54 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 96.5 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 96.48 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 96.44 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.43 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 96.39 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 95.3 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 96.18 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 96.17 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 96.16 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 96.15 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 96.14 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 96.07 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 95.96 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 95.83 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 95.67 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 95.61 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 95.6 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 95.31 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 95.24 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 95.13 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 95.1 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 94.96 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 94.87 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 94.86 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 94.83 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 94.75 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 94.55 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 94.21 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 94.16 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 94.13 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 93.91 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 93.78 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 93.78 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 93.76 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 93.57 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 93.55 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 93.52 | |
| 1uqt_A | 482 | Alpha, alpha-trehalose-phosphate synthase; glycosy | 93.43 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 93.33 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 93.29 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 93.26 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 93.15 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 92.94 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 92.94 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 92.86 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 92.76 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 92.57 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 92.51 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 92.33 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 91.97 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 91.92 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 91.62 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 91.53 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 91.45 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 91.34 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 91.32 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 91.13 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 91.09 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 91.06 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 91.05 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 91.03 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 90.98 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 90.88 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 90.85 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 90.78 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 90.7 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 90.46 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 90.04 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 89.83 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 89.58 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 89.23 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 89.16 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 88.99 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 88.98 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 88.78 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 88.6 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 88.07 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 87.71 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 87.53 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 87.07 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 86.9 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 86.5 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 86.37 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 85.96 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 85.81 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 85.14 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 84.66 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 84.33 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 83.64 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 83.28 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 82.97 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 82.81 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 82.06 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 80.54 |
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-33 Score=264.59 Aligned_cols=225 Identities=24% Similarity=0.297 Sum_probs=166.1
Q ss_pred EEEEEecCCccCCCCCCCCccCCChhHHHHHHHHHhcCCEEEEcCCChhhHHHHhCCcCceEEccCCceEeCCCCCcccC
Q 015453 118 IAIFSDYDGTLSPIVDDPDRAIMSDGMRSAVRNVAKYFPTAIITGRSRDKVYELVGLTELYYAGSHGMDIMGPVDHTVSD 197 (406)
Q Consensus 118 ~lI~lD~DGTL~~~~~~p~~~~~s~~~~~aL~~L~~~~~v~I~SGR~~~~l~~~~~l~~~~li~~nGa~I~~~~~~~~~~ 197 (406)
++||+||||||++...+|+...++++++++|++|++++.|+|+|||++..+.++++.. .++|++||+.|+. ++...
T Consensus 2 kli~~DlDGTLl~~~~~~~~~~i~~~~~~al~~l~~~g~v~iaTGR~~~~~~~~~~~l-~~~I~~nGa~i~~-~~~~~-- 77 (239)
T 1u02_A 2 SLIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPLD-INMICYHGACSKI-NGQIV-- 77 (239)
T ss_dssp CEEEEECBTTTBCCCSCGGGCCCCHHHHHHHHHHHHHSEEEEECSSCHHHHHHHSCSS-CEEEEGGGTEEEE-TTEEE--
T ss_pred eEEEEecCCCCcCCCCCcccCCCCHHHHHHHHHHhcCCCEEEEeCCCHHHHHHHhccc-hheEEECCEEEee-CCeee--
Confidence 5899999999999655555678999999999999987789999999999999998754 7999999999987 33321
Q ss_pred CCCCCcccccccCCccccccccccc-cchHHHHHHHHHHHhhhccCceeeecceeEEEEeeecCCCCHHHHHHHHHHHHh
Q 015453 198 DHPNSIKSTDQQGKEVNLFQPAREF-LPMIDEVFRTLVENTKSIKGAKVENHKFCVSVHYRNVDEKSWPTIAQCVHDVLK 276 (406)
Q Consensus 198 ~~~~~~~~~~~~~~~~~l~~~a~~~-~~~i~~v~~~l~~~~~~~~g~~vE~~~~~l~~h~r~~d~~~~~~l~~~l~~~l~ 276 (406)
+.. . .++. ..+ .+.+.++.+.+ +..++.+++.+...+.++|+.+++.. ....+.+.+.++
T Consensus 78 -~~~-----~------~~~~--~~l~~~~~~~i~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~ 138 (239)
T 1u02_A 78 -YNN-----G------SDRF--LGVFDRIYEDTRSWV----SDFPGLRIYRKNLAVLYHLGLMGADM-KPKLRSRIEEIA 138 (239)
T ss_dssp -ECT-----T------GGGG--HHHHHHHHHHHTTHH----HHSTTCEEEEETTEEEEECTTSCSTT-HHHHHHHHHHHH
T ss_pred -ecc-----c------cccc--chhhHHHHHHHHHHH----hhCCCcEEEecCCEEEEEcCCCChhH-HHHHHHHHHHHh
Confidence 000 0 0000 000 01223333333 34456777777777778887654321 223333433333
Q ss_pred hCCCeEEEecCeEEEEEcCCCCCHHHHHHHHHHHcCCCCCCCccEEEEeCCcCCHHHHHHHHhCCCceEEEecCCCCCcc
Q 015453 277 DYPRLRLTHGRKVLEIRPVIDWNKGKAVEFLLESLGLSDSDDVLPIYIGDDRTDEDAFKVLRKGNRGYGILVSSVPKETK 356 (406)
Q Consensus 277 ~~p~l~v~~g~~~lEI~P~~gvsKG~Al~~Ll~~lg~~~~~~~~viaiGD~~NDedMf~~~~~~~~G~gVaVgna~~~t~ 356 (406)
..+++.+.++..++||+|+ ++|||.||++|++.+| ++||||+.||++||+.++. |+||+|+|| +..
T Consensus 139 ~~~~~~~~~~~~~lei~~~-~~~Kg~al~~l~~~~g--------via~GD~~ND~~Ml~~a~~---g~~vam~Na--~~~ 204 (239)
T 1u02_A 139 RIFGVETYYGKMIIELRVP-GVNKGSAIRSVRGERP--------AIIAGDDATDEAAFEANDD---ALTIKVGEG--ETH 204 (239)
T ss_dssp HHHTCEEEECSSEEEEECT-TCCHHHHHHHHHTTSC--------EEEEESSHHHHHHHHTTTT---SEEEEESSS--CCC
T ss_pred ccCCcEEEeCCcEEEEEcC-CCCHHHHHHHHHhhCC--------eEEEeCCCccHHHHHHhhC---CcEEEECCC--CCc
Confidence 3235677788899999999 9999999999999987 8999999999999999632 899999998 578
Q ss_pred ceEEeCC---HHHHHHHHHHHHHhhh
Q 015453 357 AFYSLRD---PSEVQEFLLSLVRWKK 379 (406)
Q Consensus 357 A~y~l~~---~~eV~~fL~~L~~~~~ 379 (406)
|+|++.+ +++|+++|++++...+
T Consensus 205 A~~v~~~~~~~~gV~~~l~~~~~~~~ 230 (239)
T 1u02_A 205 AKFHVADYIEMRKILKFIEMLGVQKK 230 (239)
T ss_dssp CSEEESSHHHHHHHHHHHHHHHHHHC
T ss_pred ceEEeCCCCCHHHHHHHHHHHHHhcc
Confidence 9999988 7899999999885443
|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 406 | ||||
| d1u02a_ | 229 | c.108.1.15 (A:) Trehalose-6-phosphate phosphatase | 1e-34 | |
| d2amya1 | 243 | c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human ( | 2e-11 | |
| d1xvia_ | 232 | c.108.1.10 (A:) Putative mannosyl-3-phosphoglycera | 6e-09 | |
| d2fuea1 | 244 | c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human | 1e-07 | |
| d2rbka1 | 260 | c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B | 2e-06 | |
| d1wzca1 | 243 | c.108.1.10 (A:1-243) Putative mannosyl-3-phosphogl | 2e-06 | |
| d1s2oa1 | 244 | c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 { | 2e-05 | |
| d1nf2a_ | 267 | c.108.1.10 (A:) Hypothetical protein TM0651 {Therm | 4e-05 | |
| d1rkqa_ | 271 | c.108.1.10 (A:) Hypothetical protein YidA {Escheri | 2e-04 | |
| d1rlma_ | 269 | c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc | 0.002 | |
| d1wr8a_ | 230 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 0.003 |
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 229 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Trehalose-phosphatase domain: Trehalose-6-phosphate phosphatase related protein species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Score = 125 bits (315), Expect = 1e-34
Identities = 54/263 (20%), Positives = 101/263 (38%), Gaps = 39/263 (14%)
Query: 120 IFSDYDGTLSPIVDDPDRAIMSDGMRSAVRNVAKYFPTAIITGRSRDKVYELVGLTELYY 179
IF DYDGTL PI+ +P+ + G+ S + ++ + F T I+TGRS +++ + L
Sbjct: 3 IFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPLDI-NM 61
Query: 180 AGSHGMDIMGPVDHTVSDDHPNSIKSTDQQGKEVNLFQPAREFLPMIDEVFRTLVENTKS 239
HG ++ + FL + D ++
Sbjct: 62 ICYHGACSK--------------------INGQIVYNNGSDRFLGVFDRIYEDTRSWVSD 101
Query: 240 IKGAKVENHKFCVSVHYRNVDEKSWPTIAQCVHDVLKDYPRLRLTHGRKVLEIRPVIDWN 299
G ++ V H + P + + ++ + + + +G+ ++E+R N
Sbjct: 102 FPGLRIYRKNLAVLYHLGLMGADMKPKLRSRIEEIARIFG-VETYYGKMIIELRV-PGVN 159
Query: 300 KGKAVEFLLESLGLSDSDDVLPIYIGDDRTDEDAFKVLRKGNRGYGILVSSVPKETKAFY 359
KG A+ + + I GDD TDE AF+ + + ET A +
Sbjct: 160 KGSAIRSVR--------GERPAIIAGDDATDEAAFEAN-----DDALTIKVGEGETHAKF 206
Query: 360 SLRDPSEVQEFLLSLVR---WKK 379
+ D E+++ L + KK
Sbjct: 207 HVADYIEMRKILKFIEMLGVQKK 229
|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243 | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 243 | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 244 | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267 | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269 | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 406 | |||
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 100.0 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.96 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.96 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 99.96 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 99.96 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.96 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.95 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 99.94 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.93 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 99.93 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.93 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.91 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 99.88 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 99.86 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.5 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 98.98 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.84 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 98.68 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 98.68 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 98.59 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 98.48 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 98.18 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.89 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 97.88 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 97.73 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.27 | |
| d1uqta_ | 456 | Trehalose-6-phosphate synthase, OtsA {Escherichia | 97.23 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 97.15 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 97.09 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 97.02 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 96.71 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 96.7 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 96.6 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 96.29 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 95.88 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 95.88 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 95.84 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 95.4 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 95.28 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 94.79 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 94.49 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 94.2 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 93.86 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 93.54 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 93.53 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 93.32 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 92.9 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 92.67 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 92.66 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 92.53 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 92.2 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 91.86 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 91.78 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 91.63 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 91.32 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 91.02 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 90.1 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 89.82 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 89.55 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 88.86 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 88.7 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 87.97 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 87.0 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 86.63 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 85.46 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 84.44 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 82.14 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 80.98 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 80.14 |
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Trehalose-phosphatase domain: Trehalose-6-phosphate phosphatase related protein species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Probab=100.00 E-value=2.2e-35 Score=268.85 Aligned_cols=223 Identities=24% Similarity=0.367 Sum_probs=180.4
Q ss_pred EEEEecCCccCCCCCCCCccCCChhHHHHHHHHHhcCCEEEEcCCChhhHHHHhCCcCceEEccCCceEeCCCCCcccCC
Q 015453 119 AIFSDYDGTLSPIVDDPDRAIMSDGMRSAVRNVAKYFPTAIITGRSRDKVYELVGLTELYYAGSHGMDIMGPVDHTVSDD 198 (406)
Q Consensus 119 lI~lD~DGTL~~~~~~p~~~~~s~~~~~aL~~L~~~~~v~I~SGR~~~~l~~~~~l~~~~li~~nGa~I~~~~~~~~~~~ 198 (406)
|||||+||||+++..+|+++.++++++++|++|++.++|+|+|||++..+..++.. ..+++++||+.+..++.....
T Consensus 2 Li~~DlDGTL~~~~~~~~~~~i~~~~~~~l~~l~~~~~v~i~TGR~~~~l~~~~~~-~~~~~~~ng~~~~~~~~~~~~-- 78 (229)
T d1u02a_ 2 LIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPL-DINMICYHGACSKINGQIVYN-- 78 (229)
T ss_dssp EEEEECBTTTBCCCSCGGGCCCCHHHHHHHHHHHHHSEEEEECSSCHHHHHHHSCS-SCEEEEGGGTEEEETTEEEEC--
T ss_pred EEEEEecCCCCCCCCChhhCCCCHHHHHHHHHHhhCCCEEEEcCCCHHHhhhhcCc-cccEEecCeEEEecCCceeee--
Confidence 79999999999988888888999999999999998888999999999999988764 348999999998876543210
Q ss_pred CCCCcccccccCCccccccccccccchHHHHHHHHHHHhhhccCceeeecceeEEEEeeecCCCCHHHHHHHHHHHHhhC
Q 015453 199 HPNSIKSTDQQGKEVNLFQPAREFLPMIDEVFRTLVENTKSIKGAKVENHKFCVSVHYRNVDEKSWPTIAQCVHDVLKDY 278 (406)
Q Consensus 199 ~~~~~~~~~~~~~~~~l~~~a~~~~~~i~~v~~~l~~~~~~~~g~~vE~~~~~l~~h~r~~d~~~~~~l~~~l~~~l~~~ 278 (406)
.........++++.+.+.......++...+.+..+..+++............+.+...+...
T Consensus 79 ------------------~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ 140 (229)
T d1u02a_ 79 ------------------NGSDRFLGVFDRIYEDTRSWVSDFPGLRIYRKNLAVLYHLGLMGADMKPKLRSRIEEIARIF 140 (229)
T ss_dssp ------------------TTGGGGHHHHHHHHHHHTTHHHHSTTCEEEEETTEEEEECTTSCSTTHHHHHHHHHHHHHHH
T ss_pred ------------------cchhhhHHHHHHHHHHhHHhhcccCCceecccccceeeeehhhhhhhHHHHHHHHHHHhhcC
Confidence 01111224455666666555567889899988889999988777666666777777777665
Q ss_pred CCeEEEecCeEEEEEcCCCCCHHHHHHHHHHHcCCCCCCCccEEEEeCCcCCHHHHHHHHhCCCceEEEecCCCCCccce
Q 015453 279 PRLRLTHGRKVLEIRPVIDWNKGKAVEFLLESLGLSDSDDVLPIYIGDDRTDEDAFKVLRKGNRGYGILVSSVPKETKAF 358 (406)
Q Consensus 279 p~l~v~~g~~~lEI~P~~gvsKG~Al~~Ll~~lg~~~~~~~~viaiGD~~NDedMf~~~~~~~~G~gVaVgna~~~t~A~ 358 (406)
+ +.+.++..++||.|+ |+|||+|+++|++. ++++|||||.||++||+++. .||+|+||++ ++.|+
T Consensus 141 ~-~~~~~~~~~idi~p~-g~~Kg~al~~l~~~--------~~~i~~GDs~ND~~Mf~~~~---~~~av~~g~~--~~~A~ 205 (229)
T d1u02a_ 141 G-VETYYGKMIIELRVP-GVNKGSAIRSVRGE--------RPAIIAGDDATDEAAFEAND---DALTIKVGEG--ETHAK 205 (229)
T ss_dssp T-CEEEECSSEEEEECT-TCCHHHHHHHHHTT--------SCEEEEESSHHHHHHHHTTT---TSEEEEESSS--CCCCS
T ss_pred C-eEEEeeceEEEEecC-CCCHHHHHHHHhcc--------ccceeecCCCChHHHHhccC---CeEEEEeCCC--CccCe
Confidence 4 788899999999999 99999999999863 26999999999999999984 3677777764 68999
Q ss_pred EEeCCHHHHHHHHHHHHHh
Q 015453 359 YSLRDPSEVQEFLLSLVRW 377 (406)
Q Consensus 359 y~l~~~~eV~~fL~~L~~~ 377 (406)
|++++++||.+||+.|-..
T Consensus 206 ~~~~~~~ev~~~l~~l~~~ 224 (229)
T d1u02a_ 206 FHVADYIEMRKILKFIEML 224 (229)
T ss_dssp EEESSHHHHHHHHHHHHHH
T ss_pred EEcCCHHHHHHHHHHHHHH
Confidence 9999999999999988543
|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|