Citrus Sinensis ID: 015469

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MLVTSTTIALSETPSLALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGAEIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTFPKDEDGFCGCLQDSASTCNMNGGQLFAR
ccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccHHHHHccccccCEEEEEEEEEEEccccccccccEEEEEccccccHHHcccccccEEEEEccEEcccccHHHHHHHHcccccccEEEEEEEccEEEEEEEEEEEEEcccEEEEEccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHcccccEEEEEcccccccEEEccccccccccccEEEEEcccccHHHHHHHHHccccccCEEEcccccccCEEEEEEEcccccEEEEEEEEEEcccccccccccccccEEccccccccccccccccccccccccccccccccc
MLVTST*IALSET*****SEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGAEIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTFPK**********D***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVTSTTIALSETPSLALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGAEIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTFPKDEDGFCGCLQDSASTCNMNGGQLFAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
C-terminal processing peptidase, chloroplastic Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II. This proteolytic processing is necessary to allow the light-driven assembly of the tetranuclear manganese cluster, which is responsible for photosynthetic water oxidation.probableO04073
Carboxyl-terminal-processing protease Cleavage of the 16 C-terminal residues from the D1 precursor of photosystem II. May be involved in protection of the bacterium from thermal and osmotic stresses.probableP42784

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.21.-Serine endopeptidases.probable
3.4.21.102C-terminal processing peptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FC6, chain A
Confidence level:very confident
Coverage over the Query: 18-385
View the alignment between query and template
View the model in PyMOL