Query         015503
Match_columns 405
No_of_seqs    110 out of 141
Neff          3.7 
Searched_HMMs 46136
Date          Fri Mar 29 06:55:29 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/015503.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/015503hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11891 DUF3411:  Domain of un 100.0 3.2E-75   7E-80  533.7  13.8  178  171-348     1-179 (180)
  2 COG4907 Predicted membrane pro  88.1    0.36 7.9E-06   51.7   2.8    7   71-77    568-574 (595)
  3 COG4907 Predicted membrane pro  85.9    0.56 1.2E-05   50.3   2.7    7   74-80    574-580 (595)
  4 KOG3915 Transcription regulato  80.1     1.7 3.8E-05   46.8   3.6    9   73-81     61-69  (641)
  5 PF04285 DUF444:  Protein of un  70.0     6.6 0.00014   41.6   4.8   26   98-123   103-130 (421)
  6 PLN02705 beta-amylase           66.6     9.2  0.0002   42.6   5.1   13  268-280   303-315 (681)
  7 PF02979 NHase_alpha:  Nitrile   65.1     7.5 0.00016   37.3   3.7   45  137-181    16-68  (188)
  8 PRK05325 hypothetical protein;  62.6      12 0.00026   39.5   5.0   21  108-132    99-119 (401)
  9 PF02957 TT_ORF2:  TT viral ORF  61.8     8.2 0.00018   33.5   3.1   15  105-119   103-117 (122)
 10 PHA00370 III attachment protei  56.9      13 0.00027   37.7   3.8   12   20-31     19-31  (297)
 11 TIGR02877 spore_yhbH sporulati  55.4      19 0.00041   37.8   4.9   29  100-132   101-131 (371)
 12 PF08671 SinI:  Anti-repressor   52.8      17 0.00037   25.4   2.8   22  134-156     9-30  (30)
 13 PF02957 TT_ORF2:  TT viral ORF  45.5      30 0.00065   30.0   3.9   16  108-123   103-118 (122)
 14 COG4371 Predicted membrane pro  43.2      20 0.00043   36.5   2.7   20  247-266   231-250 (334)
 15 PF05297 Herpes_LMP1:  Herpesvi  39.2      10 0.00022   39.2   0.0    7   21-27    191-197 (381)
 16 PHA00370 III attachment protei  37.2      91   0.002   31.8   6.2    7  254-260   244-250 (297)
 17 PF02084 Bindin:  Bindin;  Inte  37.0      58  0.0013   32.4   4.8   25  115-142   108-132 (238)
 18 PLN02590 probable tyrosine dec  35.1      50  0.0011   35.9   4.5   25  212-236   145-169 (539)
 19 PF05084 GRA6:  Granule antigen  35.0      50  0.0011   31.7   3.9   11   28-38    129-139 (215)
 20 PRK05255 hypothetical protein;  32.6 1.9E+02  0.0041   27.4   7.3   68  117-184    26-128 (171)
 21 KOG0105 Alternative splicing f  31.9      41 0.00089   33.0   2.8    6   83-88     92-97  (241)
 22 KOG3973 Uncharacterized conser  31.2      46 0.00099   35.3   3.2    9    8-16    270-278 (465)
 23 COG4371 Predicted membrane pro  29.3      62  0.0013   33.1   3.7   13   76-88     75-87  (334)
 24 TIGR01323 nitrile_alph nitrile  28.9      61  0.0013   31.2   3.4   44  137-180    10-61  (185)
 25 COG2718 Uncharacterized conser  27.2      62  0.0013   34.6   3.4   26   97-122   102-129 (423)
 26 KOG4096 Uncharacterized conser  26.9      10 0.00022   31.6  -1.8   20  323-342    52-71  (75)
 27 PRK05325 hypothetical protein;  26.5      90   0.002   33.2   4.5   12  380-391   358-369 (401)
 28 PF07631 PSD4:  Protein of unkn  26.1 1.3E+02  0.0028   26.8   4.8   33  129-179    17-51  (128)
 29 TIGR03793 TOMM_pelo TOMM prope  25.4      41 0.00088   27.8   1.4   15  165-179    15-29  (77)
 30 PF10415 FumaraseC_C:  Fumarase  23.2 1.4E+02  0.0029   23.1   3.8   40  114-156    12-51  (55)
 31 KOG1456 Heterogeneous nuclear   22.6      65  0.0014   34.5   2.5   22  208-229   164-185 (494)
 32 PF07096 DUF1358:  Protein of u  21.2 1.2E+02  0.0027   27.6   3.7   52  282-336    31-91  (124)

No 1  
>PF11891 DUF3411:  Domain of unknown function (DUF3411);  InterPro: IPR021825  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 168 to 186 amino acids in length. This domain has a conserved RYQ sequence motif. 
Probab=100.00  E-value=3.2e-75  Score=533.73  Aligned_cols=178  Identities=51%  Similarity=0.746  Sum_probs=174.5

Q ss_pred             hhhhcchhhHHHHHHHHhhhhhhhhhhhhhccCcchHhHHHHHHHHHHHHHHHHHhhhhccccccccccccccccC-chh
Q 015503          171 ERLLADDLFLAKVLFECGVGIFTKTAAEYDRRRENFFKELEIVFADVVMAIIADFMLVYLPAPTVALRSSFAVHAG-PIS  249 (405)
Q Consensus       171 ~RlLADP~FlfKl~iE~~I~i~~~~~aE~~~Rge~F~~ElDfV~sdvv~g~i~nfaLV~LLAPt~s~g~~~a~~aG-~l~  249 (405)
                      |||||||+|||||++||+||++|+++|||++|||+||+|||||+||+++++|+||+||||||||++++++++...| .++
T Consensus         1 ~RllADP~Fl~Kl~~E~~i~i~~~~~~e~~~R~e~f~~E~d~v~~d~v~~~i~n~~lv~llAPt~s~~~~~~~~~~~~~~   80 (180)
T PF11891_consen    1 ERLLADPSFLFKLAIEEVIGIGCATAAEYAKRGERFWNELDFVFSDVVVGSIVNFALVWLLAPTRSFGSPAASSPGGGLQ   80 (180)
T ss_pred             CcccccchHHHHHHHHHHHHHHHHHHHHHHHcccchHHHHHHHHHHHHHHHHHHHHHHHhccchHhhCcccccccchHHH
Confidence            7999999999999999999999999999999999999999999999999999999999999999999998876555 899


Q ss_pred             hHhhcCCchhhhcccCCCCcchhhhHHHHhhcchhhhhhhhhHhhHHHHHHHHHHHHhhhcCCCCCCCcCCCCccchhhh
Q 015503          250 KFFYNCPDNAFQVALSGTSYSLLQRLGAIARNGAKLFAVGTTSSLVGTAVTNALINARKAVDKSSEGEVENVPILSTSVA  329 (405)
Q Consensus       250 k~~~~lP~n~Fq~~~pg~~fsl~qR~~a~v~KGa~l~~VGf~aGlvG~glsN~L~~~RK~~d~s~e~~~~~pPvl~tal~  329 (405)
                      |++++||+|+||+++|+++||++||++||+|||++|++|||+||++||++||+|+++||++||+||+++++||+++||++
T Consensus        81 ~~~~~~P~n~Fq~~~~g~~fsl~qR~~~~~~kg~~l~~VG~~ag~vg~~lsn~L~~~rk~~~~~~e~~~~~ppv~~ta~~  160 (180)
T PF11891_consen   81 KFLGSLPNNAFQKGYPGRSFSLAQRIGAFVYKGAKLAAVGFIAGLVGTGLSNALIAARKKVDPSFEPSVPVPPVLKTALG  160 (180)
T ss_pred             HHHHhChHHHhccCCCCCcccHHHHHHHHHHcchHhhhhHHHHHHHHHHHHHHHHHHHHhcCccccCCCCCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHhhcchhhhHHHHHhH
Q 015503          330 YGVYMAVSSNLRYQVLAGV  348 (405)
Q Consensus       330 wG~fMGvSSNlRYQilnGl  348 (405)
                      ||+|||+|||+|||+|||+
T Consensus       161 ~g~fmGvSsNlRYQil~Gi  179 (180)
T PF11891_consen  161 WGAFMGVSSNLRYQILNGI  179 (180)
T ss_pred             HHHHHhhhHhHHHHHHcCC
Confidence            9999999999999999998


No 2  
>COG4907 Predicted membrane protein [Function unknown]
Probab=88.10  E-value=0.36  Score=51.69  Aligned_cols=7  Identities=0%  Similarity=0.140  Sum_probs=2.5

Q ss_pred             cccCCCC
Q 015503           71 TPTSSGG   77 (405)
Q Consensus        71 ~~~~~~~   77 (405)
                      ||.+++|
T Consensus       568 a~S~~~~  574 (595)
T COG4907         568 ASSRRSS  574 (595)
T ss_pred             cccccCC
Confidence            3333333


No 3  
>COG4907 Predicted membrane protein [Function unknown]
Probab=85.86  E-value=0.56  Score=50.32  Aligned_cols=7  Identities=86%  Similarity=1.483  Sum_probs=2.7

Q ss_pred             CCCCCCC
Q 015503           74 SSGGGGG   80 (405)
Q Consensus        74 ~~~~~~~   80 (405)
                      |++|||+
T Consensus       574 ~~~GGG~  580 (595)
T COG4907         574 SSSGGGG  580 (595)
T ss_pred             CCCCCCC
Confidence            3444333


No 4  
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=80.10  E-value=1.7  Score=46.75  Aligned_cols=9  Identities=78%  Similarity=1.453  Sum_probs=3.5

Q ss_pred             cCCCCCCCC
Q 015503           73 TSSGGGGGD   81 (405)
Q Consensus        73 ~~~~~~~~~   81 (405)
                      |+.|||+++
T Consensus        61 ~~~~~g~~g   69 (641)
T KOG3915|consen   61 TSTGGGGGG   69 (641)
T ss_pred             ecccCCCCC
Confidence            333433333


No 5  
>PF04285 DUF444:  Protein of unknown function (DUF444);  InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches [].
Probab=69.97  E-value=6.6  Score=41.62  Aligned_cols=26  Identities=46%  Similarity=0.611  Sum_probs=15.1

Q ss_pred             CCCCCCCCCC--ccccCHHHHHHHHHHH
Q 015503           98 NNDGDGDGEN--AGEKNREEALIVLAEA  123 (405)
Q Consensus        98 ~~~g~~~~~~--~~~~~R~ei~~Vl~e~  123 (405)
                      ++.|+++|+|  .-+-.++|...+|=|-
T Consensus       103 ~gag~geGeD~fe~els~eE~~~llfEd  130 (421)
T PF04285_consen  103 QGAGDGEGEDDFEFELSREEFLDLLFED  130 (421)
T ss_pred             CCCCCCCCCCeEEEEEEHHHHHHHhHHH
Confidence            3345555555  3566778887666554


No 6  
>PLN02705 beta-amylase
Probab=66.59  E-value=9.2  Score=42.61  Aligned_cols=13  Identities=31%  Similarity=0.238  Sum_probs=6.3

Q ss_pred             CcchhhhHHHHhh
Q 015503          268 SYSLLQRLGAIAR  280 (405)
Q Consensus       268 ~fsl~qR~~a~v~  280 (405)
                      +|+--+++..++.
T Consensus       303 dWsgY~~L~~mvr  315 (681)
T PLN02705        303 VWSGYRELFNIIR  315 (681)
T ss_pred             CcHHHHHHHHHHH
Confidence            4444455555444


No 7  
>PF02979 NHase_alpha:  Nitrile hydratase, alpha chain;  InterPro: IPR004232 Nitrile hydratases (4.2.1.84 from EC) are bacterial enzymes that catalyse the hydration of nitrile compounds to the corresponding amides. They are used as biocatalysts in acrylamide production, one of the few commercial scale bioprocesses, as well as in environmental remediation for the removal of nitriles from waste streams. Nitrile hydratases are composed of two subunits, alpha and beta, and are normally active as a tetramer, alpha(2)beta(2). Nitrile hydratases contain either a non-haem iron or a non-corrinoid cobalt centre, both types sharing a highly conserved peptide sequence in the alpha subunit (CXLCSC) that provides all the residues involved in coordinating the metal ion. Each type of nitrile hydratase specifically incorporated its metal with the help of activator proteins encoded by flanking regions of the nitrile hydratase genes that are necessary for metal insertion. The Fe-containing enzyme is photo-regulated: in the dark the enzyme is inactivated due to the association of nitric oxide (NO) to the iron, while in the light the enzyme is active by photo-dissociation of NO. The NO is held in place by a claw setting formed through specific oxygen atoms in two modified cysteines and a serine residue in the active site [, ]. The cobalt-containing enzyme is unaffected by NO, but was shown to undergo a similar effect with carbon monoxide [, ]. Fe- and cobalt-containing enzymes also display different inhibition patterns with nitrophenols. Thiocyanate hydrolase (SCNase) is a cobalt-containing metalloenzyme with a cysteine-sulphinic acid ligand that hydrolyses thiocyanate to carbonyl sulphide and ammonia []. The two enzymes, nitrile hydratase and SCNase, are homologous over regions corresponding to almost the entire coding regions of the genes: the beta and alpha subunits of thiocyanate hydrolase were homologous to the amino- and carboxyl-terminal halves of the beta subunit of nitrile hydratase, and the gamma subunit of thiocyanate hydrolase was homologous to the alpha subunit of nitrile hydratase [].  This entry represents the structural domain of the alpha subunit of both iron- and cobalt-containing nitrile hydratases; the alpha subunit is a duplication of two structural repeats, each consisting of 4 layers, alpha/beta/beta/alpha []. This structure is also found in the related protein, the gamma subunit of thiocyanate hydrolase (SCNase).; GO: 0003824 catalytic activity, 0046914 transition metal ion binding, 0006807 nitrogen compound metabolic process; PDB: 2DPP_A 3HHT_A 1V29_A 2ZZD_I 2DXC_F 2DXB_F 2DD5_C 2DD4_C 2ZPH_A 2CYZ_A ....
Probab=65.09  E-value=7.5  Score=37.31  Aligned_cols=45  Identities=31%  Similarity=0.275  Sum_probs=31.6

Q ss_pred             HHHcCCCCHHHHHHHHHhhhh---hh--hHHHHh---hhchhhhhhcchhhHH
Q 015503          137 AIKDGRIPGAVLSRYFELEKS---GL--FKWLMQ---FGGFKERLLADDLFLA  181 (405)
Q Consensus       137 A~e~G~vs~~~L~rfl~l~~~---p~--~~~L~~---~~gfR~RlLADP~Flf  181 (405)
                      -+|.|.|+++.+.++.+...+   |.  .+.+.+   -++||+|||+||.=..
T Consensus        16 l~ekg~~~~~~~~~~~~~~~~~~~P~~GarvVArAW~Dp~FK~rLLaD~~aA~   68 (188)
T PF02979_consen   16 LIEKGLITPAEVDRIIETYESRVGPRNGARVVARAWTDPAFKARLLADPTAAI   68 (188)
T ss_dssp             HHHTTSS-HHHHHHHHHHHHHTSSHHHHHHHHHHHHH-HHHHHHHHHSHHHHH
T ss_pred             HHHcCCCCHHHHHHHHHHHHhccCccccceeehhhhCCHHHHHHHHHCHHHHH
Confidence            368999999999999887764   32  112222   4999999999997443


No 8  
>PRK05325 hypothetical protein; Provisional
Probab=62.55  E-value=12  Score=39.49  Aligned_cols=21  Identities=38%  Similarity=0.295  Sum_probs=14.7

Q ss_pred             ccccCHHHHHHHHHHHhhccccchH
Q 015503          108 AGEKNREEALIVLAEAKRSMESLPK  132 (405)
Q Consensus       108 ~~~~~R~ei~~Vl~e~grt~~sLP~  132 (405)
                      .-+-.++|...+|=|--    .||.
T Consensus        99 e~els~eE~~~~lfEdL----eLPn  119 (401)
T PRK05325         99 EFEISLEELLDLLFEDL----ELPN  119 (401)
T ss_pred             EEEecHHHHHHHHHhhc----CCCC
Confidence            45778888888877654    5654


No 9  
>PF02957 TT_ORF2:  TT viral ORF2;  InterPro: IPR004118 This entry represents the Gyroviral VP2 protein and TT viral ORF2.  Torque teno virus (TTV) is a nonenveloped and single-stranded DNA virus that was initially isolated from a Japanese patient with hepatitis of unknown aetiology, and which has since been found to infect both healthy and diseased individuals []. Numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF2 is a 150 residue protein of unknown function.  Gyroviruses are small circular single stranded viruses, such as the Chicken anaemia virus. The VP2 protein contains a set of conserved cysteine and histidine residues suggesting a zinc binding domain. VP2 may act as a scaffold protein in virion assembly and may also play a role in intracellular signaling during viral replication.
Probab=61.81  E-value=8.2  Score=33.47  Aligned_cols=15  Identities=27%  Similarity=0.479  Sum_probs=6.9

Q ss_pred             CCCccccCHHHHHHH
Q 015503          105 GENAGEKNREEALIV  119 (405)
Q Consensus       105 ~~~~~~~~R~ei~~V  119 (405)
                      ++|.++.+-+++.+.
T Consensus       103 ~ed~~~~dld~L~aa  117 (122)
T PF02957_consen  103 GEDYDEEDLDELFAA  117 (122)
T ss_pred             ccCCChHHHHHHhhh
Confidence            344555444444433


No 10 
>PHA00370 III attachment protein
Probab=56.94  E-value=13  Score=37.66  Aligned_cols=12  Identities=42%  Similarity=0.756  Sum_probs=6.3

Q ss_pred             CCCc-ccCCCCCC
Q 015503           20 NTPE-LNLNRPSP   31 (405)
Q Consensus        20 ~~~~-~~~~~~~~   31 (405)
                      .||| .-|.+|+.
T Consensus        19 ~~~eE~ClaKP~~   31 (297)
T PHA00370         19 QTPEEICLAKPPI   31 (297)
T ss_pred             CCcHHHHhcCCcc
Confidence            4443 36666653


No 11 
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=55.41  E-value=19  Score=37.79  Aligned_cols=29  Identities=38%  Similarity=0.539  Sum_probs=18.4

Q ss_pred             CCCCCCCC--ccccCHHHHHHHHHHHhhccccchH
Q 015503          100 DGDGDGEN--AGEKNREEALIVLAEAKRSMESLPK  132 (405)
Q Consensus       100 ~g~~~~~~--~~~~~R~ei~~Vl~e~grt~~sLP~  132 (405)
                      .|+|+|+|  .-+-.++|...+|=|--    .||.
T Consensus       101 ag~geGed~fe~e~s~eE~~~~lfEdL----eLPn  131 (371)
T TIGR02877       101 AGDQEGEDYYETEVTLEELFELLFEDL----ELPN  131 (371)
T ss_pred             CCCCCCcceEEEEecHHHHHHHHHhhc----cCCC
Confidence            44444554  35778888888776654    5664


No 12 
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=52.80  E-value=17  Score=25.36  Aligned_cols=22  Identities=18%  Similarity=0.471  Sum_probs=16.2

Q ss_pred             HHHHHHcCCCCHHHHHHHHHhhh
Q 015503          134 LAAAIKDGRIPGAVLSRYFELEK  156 (405)
Q Consensus       134 l~~A~e~G~vs~~~L~rfl~l~~  156 (405)
                      |.+|.++| ++.+++.+||+.++
T Consensus         9 i~eA~~~G-ls~eeir~FL~~~k   30 (30)
T PF08671_consen    9 IKEAKESG-LSKEEIREFLEFNK   30 (30)
T ss_dssp             HHHHHHTT---HHHHHHHHHHHH
T ss_pred             HHHHHHcC-CCHHHHHHHHHhCC
Confidence            66777776 89999999998764


No 13 
>PF02957 TT_ORF2:  TT viral ORF2;  InterPro: IPR004118 This entry represents the Gyroviral VP2 protein and TT viral ORF2.  Torque teno virus (TTV) is a nonenveloped and single-stranded DNA virus that was initially isolated from a Japanese patient with hepatitis of unknown aetiology, and which has since been found to infect both healthy and diseased individuals []. Numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF2 is a 150 residue protein of unknown function.  Gyroviruses are small circular single stranded viruses, such as the Chicken anaemia virus. The VP2 protein contains a set of conserved cysteine and histidine residues suggesting a zinc binding domain. VP2 may act as a scaffold protein in virion assembly and may also play a role in intracellular signaling during viral replication.
Probab=45.50  E-value=30  Score=29.99  Aligned_cols=16  Identities=19%  Similarity=0.208  Sum_probs=9.1

Q ss_pred             ccccCHHHHHHHHHHH
Q 015503          108 AGEKNREEALIVLAEA  123 (405)
Q Consensus       108 ~~~~~R~ei~~Vl~e~  123 (405)
                      +++-+-+.+++++++.
T Consensus       103 ~ed~~~~dld~L~aa~  118 (122)
T PF02957_consen  103 GEDYDEEDLDELFAAA  118 (122)
T ss_pred             ccCCChHHHHHHhhhh
Confidence            3445556666666654


No 14 
>COG4371 Predicted membrane protein [Function unknown]
Probab=43.25  E-value=20  Score=36.47  Aligned_cols=20  Identities=30%  Similarity=0.541  Sum_probs=12.2

Q ss_pred             chhhHhhcCCchhhhcccCC
Q 015503          247 PISKFFYNCPDNAFQVALSG  266 (405)
Q Consensus       247 ~l~k~~~~lP~n~Fq~~~pg  266 (405)
                      .+.++-..+|+-=||-..++
T Consensus       231 TlSN~nNql~~~g~~~a~~g  250 (334)
T COG4371         231 TLSNYNNQLPNTGFQHATDG  250 (334)
T ss_pred             HHhhhhccCcccCccccCCC
Confidence            34444456777777766554


No 15 
>PF05297 Herpes_LMP1:  Herpesvirus latent membrane protein 1 (LMP1);  InterPro: IPR007961 This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). LMP1 of HHV-4 is a 62-65 kDa plasma membrane protein possessing six membrane spanning regions, a short cytoplasmic N terminus and a long cytoplasmic carboxy tail of 200 amino acids. HHV-4 virus latent membrane protein 1 (LMP1) is essential for HHV-4 mediated transformation and has been associated with several cases of malignancies. HHV-4-like viruses in Macaca fascicularis (Cynomolgus monkeys) have been associated with high lymphoma rates in immunosuppressed monkeys [].; GO: 0019087 transformation of host cell by virus, 0016021 integral to membrane; PDB: 1CZY_E 1ZMS_B.
Probab=39.21  E-value=10  Score=39.16  Aligned_cols=7  Identities=29%  Similarity=0.283  Sum_probs=0.0

Q ss_pred             CCcccCC
Q 015503           21 TPELNLN   27 (405)
Q Consensus        21 ~~~~~~~   27 (405)
                      .+|-|..
T Consensus       191 ~~e~~~d  197 (381)
T PF05297_consen  191 AEEHNHD  197 (381)
T ss_dssp             -------
T ss_pred             Ccccccc
Confidence            4565554


No 16 
>PHA00370 III attachment protein
Probab=37.19  E-value=91  Score=31.79  Aligned_cols=7  Identities=29%  Similarity=0.729  Sum_probs=3.4

Q ss_pred             cCCchhh
Q 015503          254 NCPDNAF  260 (405)
Q Consensus       254 ~lP~n~F  260 (405)
                      .||+-+|
T Consensus       244 ~C~~FV~  250 (297)
T PHA00370        244 GCTPFVF  250 (297)
T ss_pred             CCCccee
Confidence            4555444


No 17 
>PF02084 Bindin:  Bindin;  InterPro: IPR000775 Bindin, the major protein component of the acrosome granule of sea urchin sperm, mediates species-specific adhesion of sperm to the egg surface during fertilisation [, ]. The protein coats the acrosomal process after externalisation by the acrosome reaction; it binds to sulphated, fucose-containing polysaccharides on the vitelline-layer receptor proteoglycans that cover the egg plasma membrane. Bindins from different genera show high levels of sequence similarity in both the mature bindin domain and in the probindin precursor region. The most highly conserved region is a 42-residue segment in the central portion of the mature bindin protein. This domain may be responsible for conserved functions of bindin, while the more highly divergent flanking regions may be responsible for its species-specific properties [].; GO: 0007342 fusion of sperm to egg plasma membrane
Probab=36.99  E-value=58  Score=32.40  Aligned_cols=25  Identities=24%  Similarity=0.267  Sum_probs=19.1

Q ss_pred             HHHHHHHHHhhccccchHHHHHHHHcCC
Q 015503          115 EALIVLAEAKRSMESLPKDLAAAIKDGR  142 (405)
Q Consensus       115 ei~~Vl~e~grt~~sLP~Dl~~A~e~G~  142 (405)
                      .|.+||   +.|.-+||-||-+=++.|+
T Consensus       108 ~ikavL---gaTKiDLPVDINDPYDlGL  132 (238)
T PF02084_consen  108 DIKAVL---GATKIDLPVDINDPYDLGL  132 (238)
T ss_pred             HHHHHh---cccccccccccCChhhHHH
Confidence            344444   5677899999999999985


No 18 
>PLN02590 probable tyrosine decarboxylase
Probab=35.14  E-value=50  Score=35.93  Aligned_cols=25  Identities=12%  Similarity=0.238  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHhhhhccccccc
Q 015503          212 IVFADVVMAIIADFMLVYLPAPTVA  236 (405)
Q Consensus       212 fV~sdvv~g~i~nfaLV~LLAPt~s  236 (405)
                      =++.|++++.+...+..|..+|..+
T Consensus       145 ~~lgd~l~sa~n~~~~~~~~sPa~t  169 (539)
T PLN02590        145 GFLGEMLNAGLSVVGFTWLTSPAAT  169 (539)
T ss_pred             HHHHHHHHHhcccccCCcccCchhH
Confidence            4677777777777777887777665


No 19 
>PF05084 GRA6:  Granule antigen protein (GRA6);  InterPro: IPR008119  Toxoplasma gondii is an obligate intracellular apicomplexan protozoan parasite, with a complex lifestyle involving varied hosts []. It has two phases of growth: an intestinal phase in feline hosts, and an extra-intestinal phase in other mammals. Oocysts from infected cats develop into tachyzoites, and eventually, bradyzoites and zoitocysts in the extraintestinal host []. Transmission of the parasite occurs through contact with infected cats or raw/undercooked meat; in immunocompromised individuals, it can cause severe and often lethal toxoplasmosis. Acute infection in healthy humans can sometimes also cause tissue damage [].  The protozoan utilises a variety of secretory and antigenic proteins to invade a host and gain access to the intracellular environment []. These originate from distinct organelles in the T. gondii cell termed micronemes, rhoptries, and dense granules. They are released at specific times during invasion to ensure the proteins are allocated to their correct target destinations []. Dense granule antigens (GRAs) are released from the T. gondii tachyzoite while still encapsulated in a host vacuole. Gra6, one of these moieties, is associated with the parasitophorous vacuole []. It possesses a hydrophobic central region flanked by two hydrophilic domains, and is present as a single copy gene in the Toxoplasma gondii genome []. Gra6 shares a similar function with Gra2, in that it is rapidly targeted to a network of membranous tubules that connect with the vacuolar membrane []. Indeed, these two proteins, together with Gra4, form a multimeric complex that stabilises the parasite within the vacuole.
Probab=35.02  E-value=50  Score=31.74  Aligned_cols=11  Identities=9%  Similarity=-0.052  Sum_probs=4.7

Q ss_pred             CCCCCCceeee
Q 015503           28 RPSPLPLRLSV   38 (405)
Q Consensus        28 ~~~~~~~~~~~   38 (405)
                      ||.+.+.|-..
T Consensus       129 ~~r~~~V~~~~  139 (215)
T PF05084_consen  129 RRRYSSVQEPQ  139 (215)
T ss_pred             CCCCccccccc
Confidence            44444444333


No 20 
>PRK05255 hypothetical protein; Provisional
Probab=32.65  E-value=1.9e+02  Score=27.41  Aligned_cols=68  Identities=25%  Similarity=0.298  Sum_probs=38.8

Q ss_pred             HHHHHHHhhccccc----------hHHHHHHHHcC-CC-CHHHHHH-------------------HHHhhhhh---hhHH
Q 015503          117 LIVLAEAKRSMESL----------PKDLAAAIKDG-RI-PGAVLSR-------------------YFELEKSG---LFKW  162 (405)
Q Consensus       117 ~~Vl~e~grt~~sL----------P~Dl~~A~e~G-~v-s~~~L~r-------------------fl~l~~~p---~~~~  162 (405)
                      ..-|++.|..+..|          |.+|++|+... .| +.+...|                   +++....+   -...
T Consensus        26 ~~alq~LG~~L~~Ls~~ql~~lpL~e~L~~Ai~ea~ri~~~eA~RRqlqyIGKLmR~~d~e~I~~al~~~~~~~~~~~~~  105 (171)
T PRK05255         26 AEALQDLGEELVELSKDQLAKLPLDEDLRDAILEAQRITSHEARRRQLQYIGKLMRNEDVEPIRAALDKLKNKHNQETAR  105 (171)
T ss_pred             HHHHHHHHHHHHhCCHHHHhcCCCCHHHHHHHHHHhhhccchHHHHHHHHHHHHHhhCCHHHHHHHHHHHhchhHHHHHH
Confidence            35677788877665          45677776543 35 2333333                   33332222   1234


Q ss_pred             HHhhhchhhhhhc-chhhHHHHH
Q 015503          163 LMQFGGFKERLLA-DDLFLAKVL  184 (405)
Q Consensus       163 L~~~~gfR~RlLA-DP~FlfKl~  184 (405)
                      +++.-.||+||++ |+.-+..+.
T Consensus       106 ~h~lE~wRdrLi~~~d~al~e~~  128 (171)
T PRK05255        106 FHKLERWRDRLLAEGDDALTEFL  128 (171)
T ss_pred             HHHHHHHHHHHHhCCHHHHHHHH
Confidence            5566789999999 565444443


No 21 
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]
Probab=31.85  E-value=41  Score=32.99  Aligned_cols=6  Identities=33%  Similarity=0.944  Sum_probs=2.6

Q ss_pred             CCCCCC
Q 015503           83 NYNNNG   88 (405)
Q Consensus        83 ~~~~~~   88 (405)
                      +|+++|
T Consensus        92 ~y~ggg   97 (241)
T KOG0105|consen   92 SYSGGG   97 (241)
T ss_pred             ccCCCC
Confidence            444444


No 22 
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=31.22  E-value=46  Score=35.29  Aligned_cols=9  Identities=33%  Similarity=0.205  Sum_probs=3.8

Q ss_pred             hcccccccc
Q 015503            8 FASASLSTI   16 (405)
Q Consensus         8 ~~~~~~~~~   16 (405)
                      -|..+|+.|
T Consensus       270 aArsdL~~I  278 (465)
T KOG3973|consen  270 AARSDLLYI  278 (465)
T ss_pred             HhhhhHHHH
Confidence            344444444


No 23 
>COG4371 Predicted membrane protein [Function unknown]
Probab=29.35  E-value=62  Score=33.07  Aligned_cols=13  Identities=38%  Similarity=0.843  Sum_probs=5.7

Q ss_pred             CCCCCCCCCCCCC
Q 015503           76 GGGGGDDNYNNNG   88 (405)
Q Consensus        76 ~~~~~~~~~~~~~   88 (405)
                      |||+++..|.|||
T Consensus        75 GGgY~gg~Y~GGG   87 (334)
T COG4371          75 GGGYSGGGYSGGG   87 (334)
T ss_pred             CCCCCCCCCCCCC
Confidence            3444444444444


No 24 
>TIGR01323 nitrile_alph nitrile hydratase, alpha subunit. This model describes both iron- and cobalt-containing nitrile hydratase alpha chains. It excludes the thiocyanate hydrolase gamma subunit of Thiobacillus thioparus, a sequence that appears to have evolved from within the family of nitrile hydratase alpha subunits but which differs by several indels and a more rapid accumulation of point mutations.
Probab=28.88  E-value=61  Score=31.23  Aligned_cols=44  Identities=20%  Similarity=0.167  Sum_probs=31.4

Q ss_pred             HHHcCCCCHHHHHHHHHhhhh---hhh--HHHHh---hhchhhhhhcchhhH
Q 015503          137 AIKDGRIPGAVLSRYFELEKS---GLF--KWLMQ---FGGFKERLLADDLFL  180 (405)
Q Consensus       137 A~e~G~vs~~~L~rfl~l~~~---p~~--~~L~~---~~gfR~RlLADP~Fl  180 (405)
                      -+|.|.|+++.+.+.++....   |..  +-+.+   -|.||.|||+|..=.
T Consensus        10 l~eKGli~~~~id~~i~~~~~~~gP~nGA~vVArAW~Dp~fk~~Ll~d~~aa   61 (185)
T TIGR01323        10 LKSKGLIPEGAVDQLTSLYENEWGPENGAKVVAKAWVDPEFRALLLKDATAA   61 (185)
T ss_pred             HHHcCCCCHHHHHHHHHHHHhccCCcchhhhhhHHhcCHHHHHHHHhChHHH
Confidence            368899999999998886654   421  12222   489999999998643


No 25 
>COG2718 Uncharacterized conserved protein [Function unknown]
Probab=27.22  E-value=62  Score=34.59  Aligned_cols=26  Identities=42%  Similarity=0.618  Sum_probs=13.7

Q ss_pred             CCCCCCCCCCC--ccccCHHHHHHHHHH
Q 015503           97 NNNDGDGDGEN--AGEKNREEALIVLAE  122 (405)
Q Consensus        97 ~~~~g~~~~~~--~~~~~R~ei~~Vl~e  122 (405)
                      |++.|+++++|  ...--|+|+...|=|
T Consensus       102 g~~ag~~egED~F~~~is~~e~~dllFe  129 (423)
T COG2718         102 GQAAGDGEGEDEFVFQISREEVLDLLFE  129 (423)
T ss_pred             CCccCCCCCcchhheeeehhHHHHHHHH
Confidence            33344444444  356667777655543


No 26 
>KOG4096 consensus Uncharacterized conserved protein [Function unknown]
Probab=26.89  E-value=10  Score=31.62  Aligned_cols=20  Identities=25%  Similarity=0.718  Sum_probs=17.3

Q ss_pred             ccchhhhhHHHhhcchhhhH
Q 015503          323 ILSTSVAYGVYMAVSSNLRY  342 (405)
Q Consensus       323 vl~tal~wG~fMGvSSNlRY  342 (405)
                      +++++.++|+||++-+-+||
T Consensus        52 ~~~SagtFG~FM~igs~Ir~   71 (75)
T KOG4096|consen   52 MLQSAGTFGLFMGIGSGIRC   71 (75)
T ss_pred             HHhccchhhhhhhhhhheec
Confidence            46777899999999998887


No 27 
>PRK05325 hypothetical protein; Provisional
Probab=26.46  E-value=90  Score=33.18  Aligned_cols=12  Identities=42%  Similarity=0.861  Sum_probs=6.3

Q ss_pred             hhHHHHHHHHHh
Q 015503          380 GSLLWVDYARLI  391 (405)
Q Consensus       380 Gg~~fVd~AR~t  391 (405)
                      .+.+|-.|.+..
T Consensus       358 ~~~l~~~y~~i~  369 (401)
T PRK05325        358 HQTLWREYERLQ  369 (401)
T ss_pred             chHHHHHHHHhh
Confidence            455565555443


No 28 
>PF07631 PSD4:  Protein of unknown function (DUF1592);  InterPro: IPR013042  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013039 from INTERPRO and IPR013043 from INTERPRO.
Probab=26.08  E-value=1.3e+02  Score=26.82  Aligned_cols=33  Identities=33%  Similarity=0.377  Sum_probs=22.6

Q ss_pred             cch-HHHHHHHHcCCC-CHHHHHHHHHhhhhhhhHHHHhhhchhhhhhcchhh
Q 015503          129 SLP-KDLAAAIKDGRI-PGAVLSRYFELEKSGLFKWLMQFGGFKERLLADDLF  179 (405)
Q Consensus       129 sLP-~Dl~~A~e~G~v-s~~~L~rfl~l~~~p~~~~L~~~~gfR~RlLADP~F  179 (405)
                      +.| +.|.+|++.|.+ ++++|.+                  -.+|||+||.+
T Consensus        17 s~PD~~L~~aA~~g~L~~~~~l~~------------------q~~RML~dpr~   51 (128)
T PF07631_consen   17 SPPDAELLDAAAAGELRTPEQLRA------------------QAERMLADPRA   51 (128)
T ss_pred             CCCCHHHHHHHHhCCCCCHHHHHH------------------HHHHHHcCccH
Confidence            344 457888888887 4444433                  45799999987


No 29 
>TIGR03793 TOMM_pelo TOMM propeptide domain. This model represents a domain that is conserved among a large number of putative thiazole/oxazole-modified microcins (TOMM). Oddly, most of this seqence region appears homologous to nitrile hydratase subunits. This family is expanded especially in Pelotomaculum thermopropionicum SI.
Probab=25.36  E-value=41  Score=27.85  Aligned_cols=15  Identities=27%  Similarity=0.275  Sum_probs=12.7

Q ss_pred             hhhchhhhhhcchhh
Q 015503          165 QFGGFKERLLADDLF  179 (405)
Q Consensus       165 ~~~gfR~RlLADP~F  179 (405)
                      .-+.||.||++||.=
T Consensus        15 ~Dp~Fr~~Ll~DPra   29 (77)
T TIGR03793        15 EDEAFKQALLTNPKE   29 (77)
T ss_pred             cCHHHHHHHHHCHHH
Confidence            458999999999973


No 30 
>PF10415 FumaraseC_C:  Fumarase C C-terminus;  InterPro: IPR018951  Fumarase C catalyses the stereo-specific interconversion of fumarate to L-malate as part of the Krebs cycle. The full-length protein forms a tetramer with visible globular shape. FumaraseC_C is the C-terminal 65 residues referred to as domain 3. The core of the molecule consists of a bundle of 20 alpha-helices from the five-helix bundle of domain 2. The projections from the core of the tetramer are generated from domains 1 and 3 of each subunit []. This entry does not appear to be part of either the active site or the activation site but is helical in structure forming a little bundle. ; GO: 0016829 lyase activity, 0006099 tricarboxylic acid cycle; PDB: 3RRP_A 3OCE_D 3OCF_D 3E04_B 3GTD_A 3R6V_F 3R6Q_F 1J3U_B 1FUR_A 1YFE_A ....
Probab=23.20  E-value=1.4e+02  Score=23.13  Aligned_cols=40  Identities=20%  Similarity=0.265  Sum_probs=28.1

Q ss_pred             HHHHHHHHHHhhccccchHHHHHHHHcCCCCHHHHHHHHHhhh
Q 015503          114 EEALIVLAEAKRSMESLPKDLAAAIKDGRIPGAVLSRYFELEK  156 (405)
Q Consensus       114 ~ei~~Vl~e~grt~~sLP~Dl~~A~e~G~vs~~~L~rfl~l~~  156 (405)
                      +.+.++.+++.++..++..-   +++.|.++.+++.+.|+.+.
T Consensus        12 e~aa~iAk~A~~~g~svre~---v~~~g~lt~ee~d~ll~p~~   51 (55)
T PF10415_consen   12 EKAAEIAKEALAEGRSVREV---VLEEGLLTEEELDELLDPER   51 (55)
T ss_dssp             HHHHHHHHHHHHHT--HHHH---HHHTTSS-HHHHHHHTSHHH
T ss_pred             HHHHHHHHHHHHcCCCHHHH---HHHcCCCCHHHHHHHcCHHH
Confidence            35567788888888877643   45889999999999988653


No 31 
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]
Probab=22.62  E-value=65  Score=34.53  Aligned_cols=22  Identities=14%  Similarity=0.001  Sum_probs=13.1

Q ss_pred             hHHHHHHHHHHHHHHHHHhhhh
Q 015503          208 KELEIVFADVVMAIIADFMLVY  229 (405)
Q Consensus       208 ~ElDfV~sdvv~g~i~nfaLV~  229 (405)
                      =|||=|-+-.-.=..+|-+=.|
T Consensus       164 VEFdsv~~AqrAk~alNGADIY  185 (494)
T KOG1456|consen  164 VEFDSVEVAQRAKAALNGADIY  185 (494)
T ss_pred             EeechhHHHHHHHhhccccccc
Confidence            3777666555555556666555


No 32 
>PF07096 DUF1358:  Protein of unknown function (DUF1358);  InterPro: IPR009792 This family consists of several hypothetical eukaryotic proteins of around 125 residues in length. The function of this family is unknown.
Probab=21.19  E-value=1.2e+02  Score=27.56  Aligned_cols=52  Identities=25%  Similarity=0.302  Sum_probs=27.8

Q ss_pred             chhhhhhhhhHhhHHHHHHHHHHHHhhhcCCC-CCCCcCCC------C--ccchhhhhHHHhhc
Q 015503          282 GAKLFAVGTTSSLVGTAVTNALINARKAVDKS-SEGEVENV------P--ILSTSVAYGVYMAV  336 (405)
Q Consensus       282 Ga~l~~VGf~aGlvG~glsN~L~~~RK~~d~s-~e~~~~~p------P--vl~tal~wG~fMGv  336 (405)
                      ++.++.|+.++-++|-+  ..|..+||+ ||. |..-+...      +  .-..||+||..+.+
T Consensus        31 ~~FL~~Va~~s~~aGF~--~tl~~aKKk-~p~~F~kg~~~~~~l~esGasLAlRALgWGTlyA~   91 (124)
T PF07096_consen   31 GAFLGGVAGASALAGFG--TTLALAKKK-SPKWFSKGISQTKALHESGASLALRALGWGTLYAV   91 (124)
T ss_pred             HHHHHHHHHHHHHHHHH--HHHHHHHhc-CcHHHhccCcCcccCCcchHHHHHHHHhHHHHHHH
Confidence            34455566666655554  456666766 444 43222111      1  13456899977665


Done!