BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015530
         (405 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1POI|A Chain A, Crystal Structure Of Glutaconate Coenzyme A-transferase
           From Acidaminococcus Fermentans To 2.55 Angstoms
           Resolution
 pdb|1POI|C Chain C, Crystal Structure Of Glutaconate Coenzyme A-transferase
           From Acidaminococcus Fermentans To 2.55 Angstoms
           Resolution
          Length = 317

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 9/62 (14%)

Query: 343 FFILMEQGKATRQDLDLRCEELIKEEFGESCNFDVDDAVHKLEKLGIVARVRLPGVPHIT 402
           F  + ++   T++D D  C+E +         FD+ D    L KLG    + L  VP + 
Sbjct: 259 FLKVYDKVSKTQEDFDAFCKEWV---------FDLKDHDEYLNKLGATRLINLKVVPGLG 309

Query: 403 HH 404
           +H
Sbjct: 310 YH 311


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.140    0.414 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,202,172
Number of Sequences: 62578
Number of extensions: 452387
Number of successful extensions: 2124
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 2119
Number of HSP's gapped (non-prelim): 10
length of query: 405
length of database: 14,973,337
effective HSP length: 101
effective length of query: 304
effective length of database: 8,652,959
effective search space: 2630499536
effective search space used: 2630499536
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)