BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 015530
(405 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1POI|A Chain A, Crystal Structure Of Glutaconate Coenzyme A-transferase
From Acidaminococcus Fermentans To 2.55 Angstoms
Resolution
pdb|1POI|C Chain C, Crystal Structure Of Glutaconate Coenzyme A-transferase
From Acidaminococcus Fermentans To 2.55 Angstoms
Resolution
Length = 317
Score = 28.1 bits (61), Expect = 9.7, Method: Compositional matrix adjust.
Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 9/62 (14%)
Query: 343 FFILMEQGKATRQDLDLRCEELIKEEFGESCNFDVDDAVHKLEKLGIVARVRLPGVPHIT 402
F + ++ T++D D C+E + FD+ D L KLG + L VP +
Sbjct: 259 FLKVYDKVSKTQEDFDAFCKEWV---------FDLKDHDEYLNKLGATRLINLKVVPGLG 309
Query: 403 HH 404
+H
Sbjct: 310 YH 311
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.140 0.414
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,202,172
Number of Sequences: 62578
Number of extensions: 452387
Number of successful extensions: 2124
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 2119
Number of HSP's gapped (non-prelim): 10
length of query: 405
length of database: 14,973,337
effective HSP length: 101
effective length of query: 304
effective length of database: 8,652,959
effective search space: 2630499536
effective search space used: 2630499536
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)