BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015540
         (405 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MBF|A Chain A, Crystal Structure Of Fructose Bisphosphate Aldolase From
           Encephalitozoon Cuniculi, Bound To Fructose
           1,6-Bisphosphate
 pdb|3MBD|A Chain A, Crystal Structure Of Fructose Bisphosphate Aldolase From
           Encephalitozoon Cuniculi, Bound To Phosphate
 pdb|3QRH|A Chain A, Crystal Structure Of Fructose Bisphosphate Aldolase From
           Encephalitozoon Cuniculi, Bound To Glyceraldehyde
           3-Phosphate
          Length = 342

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 223 EAVEKTDTDKNMTTMFEILRRKKSVR--LESLILNRRSFAQTVENLFALSFLVKDGRVEI 280
           E +  T+T++N     EIL   K +   +  +ILN+ +F QT  +   L+ L+K   +EI
Sbjct: 43  EKLGITNTEENRRKFREILFSTKGIERYIGGVILNQETFEQTSGSGVPLTELLKKKGIEI 102

Query: 281 AV 282
            +
Sbjct: 103 GI 104


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.128    0.355 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,303,829
Number of Sequences: 62578
Number of extensions: 335885
Number of successful extensions: 763
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 760
Number of HSP's gapped (non-prelim): 12
length of query: 405
length of database: 14,973,337
effective HSP length: 101
effective length of query: 304
effective length of database: 8,652,959
effective search space: 2630499536
effective search space used: 2630499536
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)