Citrus Sinensis ID: 015552
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 405 | ||||||
| 224074127 | 385 | predicted protein [Populus trichocarpa] | 0.854 | 0.898 | 0.739 | 1e-146 | |
| 357521469 | 465 | Zinc finger protein [Medicago truncatula | 0.955 | 0.832 | 0.683 | 1e-141 | |
| 357521467 | 374 | Zinc finger protein [Medicago truncatula | 0.849 | 0.919 | 0.727 | 1e-135 | |
| 297738020 | 375 | unnamed protein product [Vitis vinifera] | 0.864 | 0.933 | 0.723 | 1e-133 | |
| 356524640 | 371 | PREDICTED: uncharacterized protein LOC10 | 0.854 | 0.932 | 0.749 | 1e-131 | |
| 225423609 | 362 | PREDICTED: uncharacterized protein LOC10 | 0.832 | 0.930 | 0.704 | 1e-130 | |
| 224138544 | 363 | predicted protein [Populus trichocarpa] | 0.837 | 0.933 | 0.740 | 1e-129 | |
| 356513020 | 371 | PREDICTED: uncharacterized protein LOC10 | 0.854 | 0.932 | 0.735 | 1e-128 | |
| 449433517 | 372 | PREDICTED: uncharacterized protein LOC10 | 0.859 | 0.935 | 0.742 | 1e-126 | |
| 356524642 | 359 | PREDICTED: uncharacterized protein LOC10 | 0.827 | 0.933 | 0.737 | 1e-125 |
| >gi|224074127|ref|XP_002304263.1| predicted protein [Populus trichocarpa] gi|222841695|gb|EEE79242.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 524 bits (1350), Expect = e-146, Method: Compositional matrix adjust.
Identities = 273/369 (73%), Positives = 294/369 (79%), Gaps = 23/369 (6%)
Query: 1 MGKKKKRVSSKVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVHK 60
MGKKKKR +SKVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVHK
Sbjct: 1 MGKKKKRAASKVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVHK 60
Query: 61 ENVTKVPNAKPGRESTDIEIYGMQGIPPDVLAAHYGEEEEEVPSKMAKVDTSFPQLVGGV 120
E+VTKVPNAKPGRESTDIEIYGMQGIPPDVLAAHYGEEE+E PSK AKVD QLVGG+
Sbjct: 61 ESVTKVPNAKPGRESTDIEIYGMQGIPPDVLAAHYGEEEDENPSKAAKVDIPSAQLVGGM 120
Query: 121 VPGQLGVSYPPQSTLGMMQPI-----------------SAVPVPPAGWPVPPRPQPWYPQ 163
VPG LG YPP+ L MQP+ SAVP P AGWPVPPR Q W PQ
Sbjct: 121 VPGPLGAGYPPRP-LAAMQPMSGPCTLGPVKLWNYLYNSAVPAPHAGWPVPPRSQHWLPQ 179
Query: 164 HAAVSIPPPAAVGYAQQPLFPVQNVRPPLASSTSPALQPSPVVPPGMPSSTPPVTVSQPL 223
H AVSIPPPA + Y QQPLFPVQNVRPP+ S+ +PAL PS V PPG+PSSTP +VSQPL
Sbjct: 180 HPAVSIPPPAPITYTQQPLFPVQNVRPPVPSTMTPALIPSQVTPPGLPSSTP--SVSQPL 237
Query: 224 FPVVNNNTTSQSSLFSAPIPSTSIALSSSAEIKGSVDAHSSANTSVTNSYHVPSMQG-GT 282
FPV NN QSS FSAP PSTS+ SS AE++GS++ H NTS+T Y S GT
Sbjct: 238 FPV--NNNLPQSSTFSAPFPSTSLLPSSPAEVRGSMNVHLGVNTSMTTGYLTQSASASGT 295
Query: 283 LSNSHSYASGPNTGGPSIGPPPVIANKAPATQPAVNEVYLVWEDEAMSMEERRMSSVKYQ 342
L N+HSYASGPNTGGPSIGPPPVIANKAP QPAVNEVYLVW+DEAMSMEERRMS KYQ
Sbjct: 296 LGNTHSYASGPNTGGPSIGPPPVIANKAPVIQPAVNEVYLVWDDEAMSMEERRMSLPKYQ 355
Query: 343 VHDETSQVS 351
VHDETSQ+S
Sbjct: 356 VHDETSQMS 364
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357521469|ref|XP_003631023.1| Zinc finger protein [Medicago truncatula] gi|355525045|gb|AET05499.1| Zinc finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357521467|ref|XP_003631022.1| Zinc finger protein [Medicago truncatula] gi|355525044|gb|AET05498.1| Zinc finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297738020|emb|CBI27221.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356524640|ref|XP_003530936.1| PREDICTED: uncharacterized protein LOC100819009 isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225423609|ref|XP_002274291.1| PREDICTED: uncharacterized protein LOC100266425 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224138544|ref|XP_002326629.1| predicted protein [Populus trichocarpa] gi|222833951|gb|EEE72428.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356513020|ref|XP_003525212.1| PREDICTED: uncharacterized protein LOC100789368 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449433517|ref|XP_004134544.1| PREDICTED: uncharacterized protein LOC101206973 [Cucumis sativus] gi|449506782|ref|XP_004162847.1| PREDICTED: uncharacterized protein LOC101227282 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356524642|ref|XP_003530937.1| PREDICTED: uncharacterized protein LOC100819009 isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 405 | ||||||
| TAIR|locus:2015776 | 367 | SUF4 "suppressor of FRIGIDA4" | 0.333 | 0.367 | 0.742 | 3.4e-94 | |
| UNIPROTKB|E2RI65 | 457 | ZNF207 "Uncharacterized protei | 0.212 | 0.188 | 0.678 | 1.4e-41 | |
| UNIPROTKB|F1RKW7 | 464 | ZNF207 "Uncharacterized protei | 0.212 | 0.185 | 0.678 | 7.5e-41 | |
| UNIPROTKB|F1MVH9 | 420 | ZNF207 "Uncharacterized protei | 0.212 | 0.204 | 0.678 | 7.5e-41 | |
| WB|WBGene00007105 | 341 | B0035.1 [Caenorhabditis elegan | 0.261 | 0.310 | 0.581 | 5.1e-40 | |
| UNIPROTKB|J3QRS9 | 493 | ZNF207 "Zinc finger protein 20 | 0.348 | 0.286 | 0.465 | 2.2e-38 | |
| UNIPROTKB|F1PRK3 | 494 | ZNF207 "Uncharacterized protei | 0.348 | 0.285 | 0.465 | 2.2e-38 | |
| UNIPROTKB|O43670 | 478 | ZNF207 "Zinc finger protein 20 | 0.348 | 0.294 | 0.465 | 2.2e-38 | |
| ZFIN|ZDB-GENE-030131-7377 | 436 | znf207b "zinc finger protein 2 | 0.212 | 0.197 | 0.666 | 9.3e-38 | |
| UNIPROTKB|E1C275 | 465 | E1C275 "Uncharacterized protei | 0.212 | 0.184 | 0.678 | 2.4e-37 |
| TAIR|locus:2015776 SUF4 "suppressor of FRIGIDA4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 534 (193.0 bits), Expect = 3.4e-94, Sum P(2) = 3.4e-94
Identities = 101/136 (74%), Positives = 107/136 (78%)
Query: 1 MGKKKKRVSSKVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVHK 60
MGKKKKR + KVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTA GM IHVLQVHK
Sbjct: 1 MGKKKKRATEKVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTASGMVIHVLQVHK 60
Query: 61 ENVTKVPNAKPGRESTDIEIYGMQGIPPDVLAAHYGEEEEEVPSKMAKVDTSFXXXXXXX 120
ENVTKVPNAK GR+STDIEIYGMQGIPP VL AHYGEEE+E P+K+AKV+
Sbjct: 61 ENVTKVPNAKDGRDSTDIEIYGMQGIPPHVLTAHYGEEEDEPPAKVAKVEIP-SAPLGGV 119
Query: 121 XXXXXXXSYPPQSTLG 136
YPPQ G
Sbjct: 120 VPRPYGMVYPPQQVPG 135
|
|
| UNIPROTKB|E2RI65 ZNF207 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RKW7 ZNF207 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MVH9 ZNF207 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00007105 B0035.1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QRS9 ZNF207 "Zinc finger protein 207" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PRK3 ZNF207 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43670 ZNF207 "Zinc finger protein 207" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-7377 znf207b "zinc finger protein 207, b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C275 E1C275 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 405 | |||
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-04 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 6e-04 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 7e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 8e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.001 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.003 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.003 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.004 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.004 |
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Score = 47.6 bits (113), Expect = 1e-05
Identities = 40/198 (20%), Positives = 56/198 (28%), Gaps = 7/198 (3%)
Query: 126 GVSYPPQSTLGMMQPISAVPVPPAGWPVPPRPQPWYPQHAAVS---IPPPAAVGYAQQPL 182
S PPQ + + P PP P P HA VS +PP A P
Sbjct: 2675 QASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPA 2734
Query: 183 FPVQNVRPPLASST----SPALQPSPVVPPGMPSSTPPVTVSQPLFPVVNNNTTSQSSLF 238
P P + + PA P G P+ PP + + + S
Sbjct: 2735 LPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSES 2794
Query: 239 SAPIPSTSIALSSSAEIKGSVDAHSSANTSVTNSYHVPSMQGGTLSNSHSYASGPNTGGP 298
+PS A + A A + S Q G
Sbjct: 2795 RESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGG 2854
Query: 299 SIGPPPVIANKAPATQPA 316
S+ P + + P+ PA
Sbjct: 2855 SVAPGGDVRRRPPSRSPA 2872
|
Length = 3151 |
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 405 | |||
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 99.96 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 99.58 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 99.49 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 99.25 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 99.23 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 99.1 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 98.95 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 98.91 | |
| PHA00733 | 128 | hypothetical protein | 98.75 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 98.68 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.43 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 98.42 | |
| PHA00733 | 128 | hypothetical protein | 98.41 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.4 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 98.33 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 98.25 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 98.19 | |
| PHA00732 | 79 | hypothetical protein | 98.0 | |
| PHA00616 | 44 | hypothetical protein | 97.79 | |
| PHA00732 | 79 | hypothetical protein | 97.76 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 97.52 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 97.52 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 97.42 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 97.33 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 97.32 | |
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 97.31 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 97.27 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 97.23 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 97.22 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 97.06 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 97.0 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 96.71 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 96.68 | |
| PHA00616 | 44 | hypothetical protein | 96.52 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 96.28 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 95.97 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 95.86 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 95.59 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 95.46 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 95.36 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 95.21 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 94.49 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 94.46 | |
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.46 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 94.45 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 94.4 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 94.36 | |
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.31 | |
| KOG2482 | 423 | consensus Predicted C2H2-type Zn-finger protein [T | 94.17 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 93.99 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 93.33 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 93.12 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 92.93 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 92.54 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 92.11 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 91.15 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 89.35 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.94 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 88.83 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 88.02 | |
| KOG4173 | 253 | consensus Alpha-SNAP protein [Intracellular traffi | 87.2 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 86.78 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 86.43 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 85.7 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 85.19 | |
| COG4888 | 104 | Uncharacterized Zn ribbon-containing protein [Gene | 84.55 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 84.32 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 83.14 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 82.45 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 81.36 | |
| KOG2186 | 276 | consensus Cell growth-regulating nucleolar protein | 80.9 | |
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 80.38 |
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.96 E-value=2.4e-27 Score=222.31 Aligned_cols=110 Identities=56% Similarity=1.064 Sum_probs=96.9
Q ss_pred CCCCCCCCCCcccccccCcccCChhHHHHHhhcCcccccccccCCCChhhHHHHhhhhccccccccCCCCCCCCcccccc
Q 015552 1 MGKKKKRVSSKVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVHKENVTKVPNAKPGRESTDIEI 80 (405)
Q Consensus 1 mgkKkrr~geKp~C~~CgK~F~~ks~Lk~H~REKPfkC~~CgKsFs~~s~L~rH~r~hH~ekp~~cp~~kpgRk~~~C~i 80 (405)
|||||++ ..|+||.+|++.|.++..|.+|++.|+|||++|.|++.+--.|..|..++|+|...+++++..+|+..+.+|
T Consensus 1 mgrkkkk-~~kpwcwycnrefddekiliqhqkakhfkchichkkl~sgpglsihcmqvhketid~ip~av~gr~~i~vei 79 (341)
T KOG2893|consen 1 MGRKKKK-VDKPWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLFSGPGLSIHCMQVHKETIDKIPAAVHGRDNIHVEI 79 (341)
T ss_pred CCccccc-cCCceeeecccccchhhhhhhhhhhccceeeeehhhhccCCCceeehhhhhhhhhhcccccccCCcceeEEE
Confidence 8999999 789999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCChHHHHHHHhhhcCCCcccccccCCCCC
Q 015552 81 YGMQGIPPDVLAAHYGEEEEEVPSKMAKVDTSFP 114 (405)
Q Consensus 81 Cgk~F~~~s~L~~H~r~h~~e~~~k~ak~~~p~~ 114 (405)
+|+..+.++..+. ..+++.++|+.+++..+.
T Consensus 80 ygmqgip~~~~r~---~~de~~~ekr~~~d~~~~ 110 (341)
T KOG2893|consen 80 YGMQGIPSGAYRG---AADEEPDEKRSRMDNGPP 110 (341)
T ss_pred eeccCCCchhhhh---hhhcCchhhhhcccCCCC
Confidence 9999999876543 344455556666665443
|
|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 405 | |||
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 1e-05 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 2e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 1e-04 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 2e-04 |
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
Score = 43.0 bits (100), Expect = 1e-05
Identities = 12/52 (23%), Positives = 24/52 (46%), Gaps = 3/52 (5%)
Query: 14 CYYCDREFDDEKILVQHQ---KAKHFKCHVCHKKLSTAGGMAIHVLQVHKEN 62
C YC F ++ +H+ + K C C + ++ + H ++VH +N
Sbjct: 45 CPYCSLRFFSPELKQEHESKCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQN 96
|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Length = 124 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 405 | |||
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.69 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.68 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.64 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.63 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.62 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.6 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.6 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.59 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.54 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.53 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.52 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.52 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.51 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.51 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.51 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.5 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.49 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.48 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.48 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.48 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.47 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.47 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.46 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.43 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.4 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.39 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.37 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.37 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.36 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.36 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.35 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 99.33 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.31 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.31 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.29 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.28 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.28 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.28 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.26 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.25 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.25 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.25 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.24 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.24 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.22 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.22 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.21 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.21 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.19 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.19 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.17 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.15 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 99.14 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.13 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.13 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.12 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.12 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.12 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.08 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 99.07 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.05 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 99.04 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.04 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.01 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 99.01 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.99 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 98.99 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 98.99 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 98.98 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 98.98 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.97 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 98.97 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.96 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 98.95 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.93 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 98.91 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 98.9 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 98.89 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 98.88 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 98.87 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 98.85 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 98.84 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 98.77 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.7 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.69 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.67 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.65 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.62 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.62 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.61 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.61 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.61 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 98.61 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.6 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.6 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 98.6 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.6 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.6 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.6 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.59 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.59 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.59 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.59 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.58 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.58 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.58 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.58 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.58 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.58 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.58 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.58 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.58 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.57 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 98.57 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.57 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.57 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.56 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.56 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.56 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.56 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.56 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.56 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.55 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.55 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.55 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.55 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.54 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.54 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.54 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.54 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.54 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.53 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.52 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.52 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.52 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.51 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.51 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.51 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.51 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.5 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.5 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 98.5 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.5 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.5 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.49 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.49 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.49 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.49 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.49 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.49 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.49 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.49 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.48 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.48 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.48 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.47 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.47 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.47 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.47 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 98.47 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.47 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.47 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.46 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.46 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.46 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.46 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.45 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.45 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.45 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.44 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.44 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.44 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 98.44 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.44 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.44 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 98.44 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.43 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.41 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.41 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.41 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.4 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.4 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.4 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.38 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.37 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.37 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.36 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.36 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.35 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.35 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.35 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.34 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.34 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.34 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.32 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 98.32 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.31 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.31 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.31 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.3 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.3 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.29 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.28 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.28 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.28 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.28 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.27 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.27 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.27 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 98.27 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.27 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 98.27 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.27 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.27 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.26 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.26 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.26 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.26 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.26 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.26 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.26 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.26 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.25 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.25 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.25 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.25 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.25 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.25 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.25 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.25 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.24 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.24 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.23 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.23 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.22 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.22 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.22 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.22 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.22 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.22 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.21 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 98.21 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.21 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 98.2 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.19 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.19 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.19 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 98.18 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.18 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.18 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.17 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.17 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.15 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 98.14 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.14 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 98.12 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.1 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.1 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.09 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 98.09 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.08 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 98.08 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.34 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 98.07 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 98.07 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.07 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.06 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 98.06 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.05 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.05 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.05 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.04 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.04 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.03 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.03 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.03 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.03 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.02 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.02 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 98.02 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.01 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.01 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.01 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 98.01 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.01 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.01 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.01 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 98.01 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.01 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.0 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.0 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 97.99 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.99 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.99 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.24 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.98 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.98 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 97.98 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.98 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.97 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.97 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 97.97 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.97 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.96 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.96 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 97.96 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.95 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.95 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.95 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.94 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 97.94 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.94 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.94 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.94 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.93 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.93 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 97.93 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.92 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 97.91 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.91 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.9 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.89 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 97.89 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 97.89 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.89 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.87 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 97.83 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 97.83 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 97.03 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.79 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 97.76 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.76 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 97.74 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.67 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 97.64 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 97.55 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.52 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 97.52 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 97.49 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.41 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.38 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.36 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 97.35 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.35 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.34 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.29 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 97.25 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 97.25 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.23 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 97.23 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.22 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.22 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.21 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 97.2 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 97.17 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.14 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 97.11 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 97.11 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 97.1 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 97.08 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 97.07 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 96.12 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.0 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 96.99 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 96.99 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 96.98 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 96.92 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 96.89 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 95.92 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 95.88 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 96.46 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 96.4 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 96.3 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 95.55 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 94.61 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 93.88 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 89.69 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 89.09 | |
| 2elu_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.51 | |
| 2jsp_A | 87 | Transcriptional regulatory protein ROS; prokaryoti | 82.4 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 81.58 | |
| 2djr_A | 76 | Zinc finger BED domain-containing protein 2; C2H2 | 81.14 |
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
Probab=99.69 E-value=7.8e-17 Score=131.36 Aligned_cols=86 Identities=21% Similarity=0.386 Sum_probs=78.4
Q ss_pred CCCccc-ccccCcccCChhHHHHHhh----cCcccccccccCCCChhhHHHHhhhhccccccccCCCCCCCCccccccCC
Q 015552 8 VSSKVW-CYYCDREFDDEKILVQHQK----AKHFKCHVCHKKLSTAGGMAIHVLQVHKENVTKVPNAKPGRESTDIEIYG 82 (405)
Q Consensus 8 ~geKp~-C~~CgK~F~~ks~Lk~H~R----EKPfkC~~CgKsFs~~s~L~rH~r~hH~ekp~~cp~~kpgRk~~~C~iCg 82 (405)
..++.+ |.+|++.|.....|.+|++ +++|+|.+|++.|.+...|.+|++.|+++++ |.|.+|+
T Consensus 13 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~------------~~C~~C~ 80 (106)
T 2ee8_A 13 KTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKP------------FKCQECG 80 (106)
T ss_dssp CCCCCCBCSSSCCBCSSHHHHHHHHHHHCCSCCCBCSSSCCBCSCHHHHHHHGGGSCCCCT------------TSCSSSC
T ss_pred CCCcCeECCCCCCccCCHHHHHHHHHHcCCCCCcCCCCccchhCCHHHHHHHHHHhCCCCC------------eECCCcC
Confidence 356666 9999999999999999999 8999999999999999999999998887765 8999999
Q ss_pred CCCCChHHHHHHHhhhcCCCccc
Q 015552 83 MQGIPPDVLAAHYGEEEEEVPSK 105 (405)
Q Consensus 83 k~F~~~s~L~~H~r~h~~e~~~k 105 (405)
+.|.....|.+|++.|.+++...
T Consensus 81 ~~f~~~~~L~~H~~~H~~~~~~~ 103 (106)
T 2ee8_A 81 KGFCQSRTLAVHKTLHMQTSSPT 103 (106)
T ss_dssp CCCSSHHHHHHHHHHTTSCCCCC
T ss_pred CcccCHHHHHHHHHHhCCCCCCc
Confidence 99999999999999999876553
|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A | Back alignment and structure |
|---|
| >2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 405 | ||||
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 9e-04 | |
| d1zr9a1 | 67 | g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 | 0.003 |
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Transcriptional repressor CTCF species: Human (Homo sapiens) [TaxId: 9606]
Score = 34.6 bits (80), Expect = 9e-04
Identities = 14/34 (41%), Positives = 23/34 (67%)
Query: 30 HQKAKHFKCHVCHKKLSTAGGMAIHVLQVHKENV 63
H K ++C++CH + + +G M +H+LQ H ENV
Sbjct: 3 HSGEKPYECYICHARFTQSGTMKMHILQKHTENV 36
|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 405 | |||
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.37 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.31 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.8 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.79 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.78 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 98.72 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.72 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.71 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.65 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.59 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 98.54 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.54 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 98.5 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.5 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.46 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.46 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.41 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.38 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.38 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 98.27 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.24 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.23 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.21 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.2 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.17 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.16 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.15 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.14 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.05 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.0 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 97.95 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 97.94 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.9 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 97.84 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 97.8 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.68 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.55 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 97.52 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.51 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.49 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.48 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.36 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.29 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.22 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.18 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.13 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.08 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.04 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 97.04 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 96.98 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 96.94 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.92 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 96.87 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.77 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.64 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.54 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.41 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 96.41 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.36 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.3 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 96.22 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.05 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 96.03 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 95.92 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 95.8 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 95.55 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 95.41 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 95.36 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 95.1 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 94.84 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 94.63 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 94.56 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 94.47 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 94.44 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 94.44 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 94.37 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 93.66 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 93.42 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 93.4 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 93.24 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 92.93 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 92.02 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 91.99 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 91.86 | |
| d2drpa1 | 37 | Tramtrack protein (two zinc-finger peptide) {Droso | 91.71 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 91.26 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 90.51 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 90.23 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 88.89 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 88.63 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 88.1 | |
| d2j7ja1 | 28 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 86.85 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 86.36 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 86.15 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 85.79 | |
| d2ctda2 | 30 | Zinc finger protein 512, ZNF512 {Human (Homo sapie | 85.49 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 85.3 | |
| d1tf3a3 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 85.16 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 84.97 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 83.38 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 83.31 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 81.75 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.37 E-value=8.2e-14 Score=100.78 Aligned_cols=53 Identities=15% Similarity=0.161 Sum_probs=41.0
Q ss_pred cCcccccccccCCCChhhHHHHhhhhccccccccCCCCCCCCccccccCCCCCCChHHHHHHHhhh
Q 015552 33 AKHFKCHVCHKKLSTAGGMAIHVLQVHKENVTKVPNAKPGRESTDIEIYGMQGIPPDVLAAHYGEE 98 (405)
Q Consensus 33 EKPfkC~~CgKsFs~~s~L~rH~r~hH~ekp~~cp~~kpgRk~~~C~iCgk~F~~~s~L~~H~r~h 98 (405)
||+|+|+ |||+|.++.+|.+|+++|.++++ |.|.+||+.|...+.|.+|+++|
T Consensus 1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekp------------y~C~~C~k~F~~~~~L~~H~r~H 53 (53)
T d2csha1 1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRP------------YGCGVCGKKFKMKHHLVGHMKIH 53 (53)
T ss_dssp CCCEECT-TSCEESSHHHHHHHHHHHSCCCS------------EECTTTSCEESSSHHHHHHHTTT
T ss_pred CcCCCCC-CCCeECCHHHhHHHhhccccccC------------CcCCCcCCEecCHHHHHHHHhcC
Confidence 6778884 88888888888888777777665 77778888888888888887765
|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|