BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 015555
(405 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|B4N549|QTRD1_DROWI Queuine tRNA-ribosyltransferase subunit QTRTD1 homolog
OS=Drosophila willistoni GN=GK20504 PE=3 SV=1
Length = 428
Score = 32.0 bits (71), Expect = 8.0, Method: Compositional matrix adjust.
Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 3/73 (4%)
Query: 197 GVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRA---RTKKFHRRVYDLRGSV 253
G E+ P RY+EI+ S +I Q D ++ K ++ RT++F +Y+ G +
Sbjct: 128 GKESLTPERYMEIIASFKPDIYQGLCDADTNLESSKKRVQKSVDRTERFMDYIYEQHGKL 187
Query: 254 KCTNISEGPPCTG 266
+ T+ S P G
Sbjct: 188 QSTSSSLLAPIVG 200
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.322 0.136 0.427
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 154,813,943
Number of Sequences: 539616
Number of extensions: 6590039
Number of successful extensions: 12811
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 12810
Number of HSP's gapped (non-prelim): 10
length of query: 405
length of database: 191,569,459
effective HSP length: 120
effective length of query: 285
effective length of database: 126,815,539
effective search space: 36142428615
effective search space used: 36142428615
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)