Citrus Sinensis ID: 015567

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----

MGKRGGIQLFDDKRDGFFSICDLASQCNFIQGENFQYPYQPGGLFASVGQMGMNFGVSPNASNSPDNNGGGGGGIKSTFHDLYVKYVPSQDSACIVELPEGEKALKKKKGGLKLKIKIANPSLRRLFSGAIAGAVSRTAVAPLETIRTHLMVGTSGHSTAEVFQNIMQTDGWKGLFRGNLVNVIRVAPSKAIELFAFDTVNKHLSAKPGEPSKVPIPASLIAGACAGVSSTLCTYPLELVKTRLTIQGDAYNGIVDAFVKIIRQEGPAELFRGLAPSLIGVIPYSATNYFAYDTLRKTYRKVFKQEKIGNIETLLIGSMAGAISSSATFPLEVARKQMQVGALSGRQVYKNVLHALASILEKEGLPGLYKGLGPSCMKLVPAAGISFMCYEACKRILVEKDGEA

cccccccccccccccccEEccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHccccECcccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHHccccEEccccccccccccccHHHHHHHHHHHHHHHHHHcccc

******IQLFDDKRDGFFSICDLASQCNFIQGENFQYPYQPGGLFASVGQMGMN*GV*******P*NNGGGGGGIKSTFHDLYVKYVPSQDSACIVELPEG***L**KKGGLKLKIKIANPSLRRLFSGAIAGAVSRTAVAPLETIRTHLMVGTSGHSTAEVFQNIMQTDGWKGLFRGNLVNVIRVAPSKAIELFAFDTVNKHLSA*P*****VPIPASLIAGACAGVSSTLCTYPLELVKTRLTIQGDAYNGIVDAFVKIIRQEGPAELFRGLAPSLIGVIPYSATNYFAYDTLRKTYRKVFKQEKIGNIETLLIGSMAGAISSSATFPLEVARKQMQVGALSGRQVYKNVLHALASILEKEGLPGLYKGLGPSCMKLVPAAGISFMCYEACKRILVE*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Adenine nucleotide transporter BT1, chloroplastic/mitochondrial	Probable mitochondrial adenylate carrier that catalyzes the transport of ATP, ADP and AMP, but not ADP-glucose. Recombinant BT1 shows a unidirectional mode of transport in intact E.coli cells. May function as a plastidial nucleotide uniport carrier required to export newly synthesized adenylates into the cytosol. May be involved in abiotic stress response.	probable	Q9SUV1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 125-400
View the alignment between query and template
View the model in PyMOL