Citrus Sinensis ID: 015586

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRRNRYRDSFK
ccccEEEHHHHHHcccccccHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHccccccccHHHcHHHHHHcEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccEEEcccccccccccEEEEccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccc
cccEEEEEcHHccccHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcHEEccEEEEccccccEEEEEEcccccccHHHHHHHccccHHHHHHHccEEEEEEEEcccccccccccccEEEcccccEEEEEccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHccccHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccc
MGATYIKLGqfiassptlfppeyVEEFQncfdrtpavpfgeiKRTLLEDlgrpiesvyeyvdptpiasaSVAQVHGarlrgsqdDVVIKVLKPGIEDVLVADLNFVYVVARILEFlnpelsrtsMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGltrqatapkvyqhcstRRVLTMErlygvpltdldsisslvsspenslITALNVWFGSLLACETFhadvhagnlwllrdgrigfldfgivgrispkTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVVATArgtttnttavsANIVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTrllapnmnmlqdQRISIVSNrrnryrdsfk
mgatyiklgqfiasspTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILeflnpelsrtsmVGIVKDIRESMleevdfkkeAANIESFRRYLEAMGLtrqatapkvyqhcSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVVAtargtttnttavsanivvdeRQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLapnmnmlqdqrisivsnrrnryrdsfk
MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELvvatargtttnttavsanivvDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRRNRYRDSFK
***TYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVV****************IVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLAPNMNMLQDQRI***************
MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRR*RY*****
MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRRNRYRDSFK
MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRRNR******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRRNRYRDSFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query404 2.2.26 [Sep-21-2011]
Q9ASX5540 Uncharacterized aarF doma yes no 0.997 0.746 0.866 0.0
P96936488 Uncharacterized protein R yes no 0.903 0.747 0.337 2e-51
A4STK9 546 Probable ubiquinone biosy yes no 0.878 0.650 0.279 1e-37
A9KYL6 549 Probable ubiquinone biosy yes no 0.873 0.642 0.296 3e-37
A6WIE7 549 Probable ubiquinone biosy yes no 0.873 0.642 0.296 3e-37
A0KEF8 546 Probable ubiquinone biosy yes no 0.883 0.653 0.273 3e-37
Q7NZD1508 Probable ubiquinone biosy yes no 0.878 0.698 0.287 1e-36
P73627 585 Uncharacterized protein s N/A no 0.881 0.608 0.259 1e-36
A3D9F4 549 Probable ubiquinone biosy yes no 0.873 0.642 0.293 1e-36
B8E6B4 549 Probable ubiquinone biosy yes no 0.873 0.642 0.293 1e-36
>sp|Q9ASX5|Y5520_ARATH Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic OS=Arabidopsis thaliana GN=At5g05200 PE=1 SV=1 Back     alignment and function desciption
 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/404 (86%), Positives = 386/404 (95%), Gaps = 1/404 (0%)

Query: 1   MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEY 60
           MGATYIKLGQFIAS+PTLFPPEYV+EFQNCFD+ P VPF EI++ L E+LGRPIESVYEY
Sbjct: 136 MGATYIKLGQFIASAPTLFPPEYVKEFQNCFDKAPPVPFEEIRKILQEELGRPIESVYEY 195

Query: 61  VDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPEL 120
           VDPTPIASAS+AQVHGARLRGSQ+DVVIKVLKPGIED LVADLNF+YVV+RI EFL+PE 
Sbjct: 196 VDPTPIASASIAQVHGARLRGSQEDVVIKVLKPGIEDFLVADLNFIYVVSRIFEFLSPEF 255

Query: 121 SRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVL 180
           SRTS+VGIVKDIRESMLEEVDF KEA NIESF+RYLE MGLT QATAP+VY++CS+RRVL
Sbjct: 256 SRTSLVGIVKDIRESMLEEVDFNKEAQNIESFKRYLETMGLTGQATAPRVYKYCSSRRVL 315

Query: 181 TMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGR 240
           TMERLYGVPLTDLDSI SLVSSPENSLITALNVWFGSLLACE+FHADVHAGNLWLLRDGR
Sbjct: 316 TMERLYGVPLTDLDSIRSLVSSPENSLITALNVWFGSLLACESFHADVHAGNLWLLRDGR 375

Query: 241 IGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEK 300
           IGFLDFGIVGRISPKTWAAM++FLASIATEEYESMASALI+MGAT++D+D KAFA+DLEK
Sbjct: 376 IGFLDFGIVGRISPKTWAAMEVFLASIATEEYESMASALIQMGATNRDVDGKAFAKDLEK 435

Query: 301 IFSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREF 360
           +FSSIQELDTE+VVATARGT ++TTAV+AN+V+DERQMNALFLDL+RVSESYGLKFPREF
Sbjct: 436 MFSSIQELDTEIVVATARGTNSDTTAVAANVVMDERQMNALFLDLVRVSESYGLKFPREF 495

Query: 361 ALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRR-NRYRDSF 403
           ALLLKQLLYFDRYTRLLAPN+NMLQDQRISI SN+R N Y+DSF
Sbjct: 496 ALLLKQLLYFDRYTRLLAPNLNMLQDQRISIASNKRTNGYKDSF 539

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: -EC: .EC: -
>sp|P96936|Y647_MYCTU Uncharacterized protein Rv0647c/MT0675 OS=Mycobacterium tuberculosis GN=Rv0647c PE=3 SV=1 Back     alignment and function description
>sp|A4STK9|UBIB_AERS4 Probable ubiquinone biosynthesis protein UbiB OS=Aeromonas salmonicida (strain A449) GN=ubiB PE=3 SV=1 Back     alignment and function description
>sp|A9KYL6|UBIB_SHEB9 Probable ubiquinone biosynthesis protein UbiB OS=Shewanella baltica (strain OS195) GN=ubiB PE=3 SV=1 Back     alignment and function description
>sp|A6WIE7|UBIB_SHEB8 Probable ubiquinone biosynthesis protein UbiB OS=Shewanella baltica (strain OS185) GN=ubiB PE=3 SV=1 Back     alignment and function description
>sp|A0KEF8|UBIB_AERHH Probable ubiquinone biosynthesis protein UbiB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240) GN=ubiB PE=3 SV=1 Back     alignment and function description
>sp|Q7NZD1|UBIB_CHRVO Probable ubiquinone biosynthesis protein UbiB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiB PE=3 SV=1 Back     alignment and function description
>sp|P73627|Y1770_SYNY3 Uncharacterized protein sll1770 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1770 PE=3 SV=1 Back     alignment and function description
>sp|A3D9F4|UBIB_SHEB5 Probable ubiquinone biosynthesis protein UbiB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiB PE=3 SV=1 Back     alignment and function description
>sp|B8E6B4|UBIB_SHEB2 Probable ubiquinone biosynthesis protein UbiB OS=Shewanella baltica (strain OS223) GN=ubiB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query404
225448729 539 PREDICTED: uncharacterized aarF domain-c 1.0 0.749 0.873 0.0
224128035 543 predicted protein [Populus trichocarpa] 1.0 0.744 0.873 0.0
18414821 540 aarF domain-containing protein kinase [A 0.997 0.746 0.866 0.0
9759261 509 unnamed protein product [Arabidopsis tha 1.0 0.793 0.864 0.0
297810631 540 ABC1 family protein [Arabidopsis lyrata 1.0 0.748 0.861 0.0
449457387 543 PREDICTED: uncharacterized aarF domain-c 1.0 0.744 0.836 0.0
357490305 534 aarF domain-containing protein kinase, p 0.987 0.747 0.844 0.0
147794585 517 hypothetical protein VITISV_017535 [Viti 0.992 0.775 0.829 0.0
356552999 541 PREDICTED: uncharacterized aarF domain-c 0.985 0.735 0.851 0.0
357129917 548 PREDICTED: uncharacterized aarF domain-c 0.987 0.728 0.788 0.0
>gi|225448729|ref|XP_002275465.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic [Vitis vinifera] gi|297736469|emb|CBI25340.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/404 (87%), Positives = 387/404 (95%)

Query: 1   MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEY 60
           MGATYIKLGQFIAS+PTLFPPEYV+EFQ+CFDR PAVPF +I+R L E+LGRPI+SVYEY
Sbjct: 136 MGATYIKLGQFIASAPTLFPPEYVQEFQSCFDRAPAVPFEDIQRVLREELGRPIDSVYEY 195

Query: 61  VDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPEL 120
           VDPTPIASAS+AQVHGA+LRGSQ+DVVIKVLKPGIED+LVADLNFVY+VARILEFLNPEL
Sbjct: 196 VDPTPIASASIAQVHGAKLRGSQEDVVIKVLKPGIEDILVADLNFVYIVARILEFLNPEL 255

Query: 121 SRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVL 180
            R S+VGIVKDIRESMLEEVDF KEAANIE+FRRYLEAMGLTRQATAPKVY  CSTRRVL
Sbjct: 256 GRASLVGIVKDIRESMLEEVDFNKEAANIEAFRRYLEAMGLTRQATAPKVYHQCSTRRVL 315

Query: 181 TMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGR 240
           TM+RLYGVPLTDLDSISSLVSSPE SL+TALNVWFGSLLACETFHADVHAGNLWLLRDGR
Sbjct: 316 TMQRLYGVPLTDLDSISSLVSSPETSLVTALNVWFGSLLACETFHADVHAGNLWLLRDGR 375

Query: 241 IGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEK 300
           IGFLDFGIVGRISPKTWAAM++FL SIATEEYESMASALIEMGAT+KD+D +AFARDLEK
Sbjct: 376 IGFLDFGIVGRISPKTWAAMEVFLESIATEEYESMASALIEMGATNKDVDFRAFARDLEK 435

Query: 301 IFSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREF 360
           IFSSIQ+LDTE++VAT RG +TNTTAV+AN+VVDERQMNALFLD++RVSESYGL+FPREF
Sbjct: 436 IFSSIQDLDTEIIVATTRGPSTNTTAVAANVVVDERQMNALFLDVVRVSESYGLRFPREF 495

Query: 361 ALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRRNRYRDSFK 404
           ALL+KQLLYFDRYTRLLAPN+NMLQDQRI+IVSNR  R RD+FK
Sbjct: 496 ALLMKQLLYFDRYTRLLAPNLNMLQDQRITIVSNRGGRNRDTFK 539

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224128035|ref|XP_002329238.1| predicted protein [Populus trichocarpa] gi|222871019|gb|EEF08150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18414821|ref|NP_568150.1| aarF domain-containing protein kinase [Arabidopsis thaliana] gi|75261770|sp|Q9ASX5.1|Y5520_ARATH RecName: Full=Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic; Flags: Precursor gi|13605575|gb|AAK32781.1|AF361613_1 AT5g05200/K2A11_7 [Arabidopsis thaliana] gi|14334952|gb|AAK59653.1| unknown protein [Arabidopsis thaliana] gi|16648993|gb|AAL24348.1| Unknown protein [Arabidopsis thaliana] gi|17104611|gb|AAL34194.1| unknown protein [Arabidopsis thaliana] gi|20259938|gb|AAM13316.1| unknown protein [Arabidopsis thaliana] gi|22137078|gb|AAM91384.1| At5g05200/K2A11_7 [Arabidopsis thaliana] gi|332003457|gb|AED90840.1| aarF domain-containing protein kinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9759261|dbj|BAB09696.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297810631|ref|XP_002873199.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata] gi|297319036|gb|EFH49458.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449457387|ref|XP_004146430.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357490305|ref|XP_003615440.1| aarF domain-containing protein kinase, putative [Medicago truncatula] gi|355516775|gb|AES98398.1| aarF domain-containing protein kinase, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|147794585|emb|CAN78034.1| hypothetical protein VITISV_017535 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552999|ref|XP_003544846.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357129917|ref|XP_003566606.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query404
TAIR|locus:2156804540 AT5G05200 [Arabidopsis thalian 0.997 0.746 0.829 9.3e-178
UNIPROTKB|P96936488 MT0675 "Uncharacterized protei 0.732 0.606 0.356 1.6e-51
UNIPROTKB|Q74E76561 GSU1088 "Quinone biosynthesis 0.745 0.536 0.307 1.4e-42
TIGR_CMR|GSU_1088561 GSU_1088 "ubiquinone biosynthe 0.745 0.536 0.307 1.4e-42
TIGR_CMR|SO_4201549 SO_4201 "ubiquinone biosynthes 0.722 0.531 0.311 7.6e-39
UNIPROTKB|Q9KVQ4544 ubiB "Probable ubiquinone bios 0.707 0.525 0.313 1.8e-37
TIGR_CMR|VC_0085544 VC_0085 "ubiquinone biosynthes 0.707 0.525 0.313 1.8e-37
TIGR_CMR|CBU_2019541 CBU_2019 "ubiquinone biosynthe 0.732 0.547 0.307 4.5e-36
TIGR_CMR|SPO_0144509 SPO_0144 "2-polyprenylphenol 6 0.75 0.595 0.311 6.1e-36
TAIR|locus:2128116 682 ACDO1 "ABC1-like kinase relate 0.742 0.439 0.311 1.1e-35
TAIR|locus:2156804 AT5G05200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1726 (612.6 bits), Expect = 9.3e-178, P = 9.3e-178
 Identities = 335/404 (82%), Positives = 366/404 (90%)

Query:     1 MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEY 60
             MGATYIKLGQFIAS+PTLFPPEYV+EFQNCFD+ P VPF EI++ L E+LGRPIESVYEY
Sbjct:   136 MGATYIKLGQFIASAPTLFPPEYVKEFQNCFDKAPPVPFEEIRKILQEELGRPIESVYEY 195

Query:    61 VDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPEL 120
             VDPTPIASAS+AQVHGARLRGSQ+DVVIKVLKPGIED LVADLNF+YVV+RI EFL+PE 
Sbjct:   196 VDPTPIASASIAQVHGARLRGSQEDVVIKVLKPGIEDFLVADLNFIYVVSRIFEFLSPEF 255

Query:   121 SRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVL 180
             SRTS+VGIVKDIRESMLEEVDF KEA NIESF+RYLE MGLT QATAP+VY++CS+RRVL
Sbjct:   256 SRTSLVGIVKDIRESMLEEVDFNKEAQNIESFKRYLETMGLTGQATAPRVYKYCSSRRVL 315

Query:   181 TMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGR 240
             TMERLYGVPLTDLDSI SLVSSPENSLITALNVWFGSLLACE+FHADVHAGNLWLLRDGR
Sbjct:   316 TMERLYGVPLTDLDSIRSLVSSPENSLITALNVWFGSLLACESFHADVHAGNLWLLRDGR 375

Query:   241 IGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEK 300
             IGFLDFGIVGRISPKTWAAM++FLASIATEEYESMASALI+MGAT++D+D KAFA+DLEK
Sbjct:   376 IGFLDFGIVGRISPKTWAAMEVFLASIATEEYESMASALIQMGATNRDVDGKAFAKDLEK 435

Query:   301 IFSSIQELDTELXXXXXXXXXXXXXXXXXXXXXDERQMNALFLDLLRVSESYGLKFPREF 360
             +FSSIQELDTE+                     DERQMNALFLDL+RVSESYGLKFPREF
Sbjct:   436 MFSSIQELDTEIVVATARGTNSDTTAVAANVVMDERQMNALFLDLVRVSESYGLKFPREF 495

Query:   361 ALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRR-NRYRDSF 403
             ALLLKQLLYFDRYTRLLAPN+NMLQDQRISI SN+R N Y+DSF
Sbjct:   496 ALLLKQLLYFDRYTRLLAPNLNMLQDQRISIASNKRTNGYKDSF 539
GO:0005886 "plasma membrane" evidence=ISM
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0010287 "plastoglobule" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
UNIPROTKB|P96936 MT0675 "Uncharacterized protein Rv0647c/MT0675" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q74E76 GSU1088 "Quinone biosynthesis kinase AarF, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1088 GSU_1088 "ubiquinone biosynthesis protein AarF, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4201 SO_4201 "ubiquinone biosynthesis protein AarF" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVQ4 ubiB "Probable ubiquinone biosynthesis protein UbiB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0085 VC_0085 "ubiquinone biosynthesis protein AarF, putative" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_2019 CBU_2019 "ubiquinone biosynthesis protein AarF, putative" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0144 SPO_0144 "2-polyprenylphenol 6-hydroxylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TAIR|locus:2128116 ACDO1 "ABC1-like kinase related to chlorophyll degradation and oxidative stress 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ASX5Y5520_ARATH2, ., 7, ., -, ., -0.86630.99750.7462yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.125.230.1
hypothetical protein (501 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.2627.7.1
Predicted protein (172 aa)
     •  0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
COG0661517 COG0661, AarF, Predicted unusual protein kinase [G 2e-89
TIGR01982437 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase 6e-79
PRK04750537 PRK04750, ubiB, putative ubiquinone biosynthesis p 1e-44
pfam03109117 pfam03109, ABC1, ABC1 family 2e-31
>gnl|CDD|223733 COG0661, AarF, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information 
 Score =  279 bits (715), Expect = 2e-89
 Identities = 130/387 (33%), Positives = 198/387 (51%), Gaps = 31/387 (8%)

Query: 1   MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEY 60
           +G T+IKLGQ +++ P L PPEY EE     DR P  PF E +R + E+LGRPIE ++  
Sbjct: 68  LGPTFIKLGQILSTRPDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSE 127

Query: 61  VDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPEL 120
            +P PIASAS+AQVH A L+ S ++V +KV +PGI + + ADL  +  +AR+++ L P  
Sbjct: 128 FEPEPIASASIAQVHRAVLK-SGEEVAVKVQRPGIRERIEADLKLLRRLARLIKRLPPGG 186

Query: 121 SRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVL 180
            R  +V +V +  + + EE+D+++EAAN E FR   +          PKVY   +TRRVL
Sbjct: 187 RRLDLVEVVDEFEKRLREELDYRREAANAERFRENFK---DDPDVYVPKVYWEYTTRRVL 243

Query: 181 TMERLYGVPLTDLDSISSLVSSPENSLITAL--NVWFGSLLACETFHADVHAGNLWLLRD 238
           TME + G+ ++D+ ++ S  +  +   +  L    +   LL    FHAD H GN+ +  D
Sbjct: 244 TMEWIDGIKISDIAALKS--AGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSD 301

Query: 239 GRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDL 298
           GRI  LDFGIVGR+ PK    +   L +    +Y+ +A   +E+G    D D    A  +
Sbjct: 302 GRIVLLDFGIVGRLDPKFRRYLAELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAAI 361

Query: 299 EKIFSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPR 358
             +   I                           ++E     +   L  V+  + ++ P 
Sbjct: 362 RAVLEPIYGKP-----------------------LEEISFGEILDKLFEVARRFPMRLPP 398

Query: 359 EFALLLKQLLYFDRYTRLLAPNMNMLQ 385
           E  LL + LL  +   R L P  N+  
Sbjct: 399 ELVLLQRTLLLVEGVGRQLDPRFNLWA 425

Length = 517
>gnl|CDD|233667 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>gnl|CDD|235310 PRK04750, ubiB, putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>gnl|CDD|111949 pfam03109, ABC1, ABC1 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 404
COG0661517 AarF Predicted unusual protein kinase [General fun 100.0
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 100.0
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 100.0
KOG1235538 consensus Predicted unusual protein kinase [Genera 100.0
KOG1236565 consensus Predicted unusual protein kinase [Genera 100.0
KOG1234363 consensus ABC (ATP binding cassette) 1 protein [Ge 100.0
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 99.95
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.94
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.92
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.92
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 99.91
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.9
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.89
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.89
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.89
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.88
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.88
KOG0605550 consensus NDR and related serine/threonine kinases 99.88
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.88
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.87
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.87
KOG0581364 consensus Mitogen-activated protein kinase kinase 99.87
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.86
KOG0578550 consensus p21-activated serine/threonine protein k 99.85
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.85
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.85
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.85
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.85
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.85
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.84
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.84
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.84
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.84
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.84
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.84
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.84
smart00090237 RIO RIO-like kinase. 99.84
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.84
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.84
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.84
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.83
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.83
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.83
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.83
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.83
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.83
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.83
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.83
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.83
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.83
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.83
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.82
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.82
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.82
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.82
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.82
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.82
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.82
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.82
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.82
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.81
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.81
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.81
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.81
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.81
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.8
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.8
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.8
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.8
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.8
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.8
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.8
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.8
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.8
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.8
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.8
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.8
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.8
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.8
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.79
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.79
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.79
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.79
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.79
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.79
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.79
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.79
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.79
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.79
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.78
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.78
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.78
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.78
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.78
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.78
PTZ00267 478 NIMA-related protein kinase; Provisional 99.78
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.77
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.77
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.77
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.77
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.77
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.77
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.77
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.77
PTZ00283 496 serine/threonine protein kinase; Provisional 99.77
KOG0589 426 consensus Serine/threonine protein kinase [General 99.76
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.76
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.76
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.76
KOG0198313 consensus MEKK and related serine/threonine protei 99.76
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.76
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.76
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.75
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.75
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.75
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.75
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.75
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.75
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.75
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.75
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.75
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.74
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.74
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.74
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.74
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.74
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.74
KOG0586 596 consensus Serine/threonine protein kinase [General 99.74
PRK14879211 serine/threonine protein kinase; Provisional 99.74
PTZ00036440 glycogen synthase kinase; Provisional 99.74
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.74
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.74
PHA02988283 hypothetical protein; Provisional 99.74
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.74
PRK09188365 serine/threonine protein kinase; Provisional 99.73
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.73
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.73
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.73
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.73
KOG0610459 consensus Putative serine/threonine protein kinase 99.73
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.73
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.73
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.73
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.73
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.73
PTZ00284467 protein kinase; Provisional 99.73
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.72
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.72
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.72
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.72
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.72
PHA03212391 serine/threonine kinase US3; Provisional 99.72
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.72
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.72
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.72
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.72
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.72
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.72
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.72
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.72
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.71
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.71
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.71
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.71
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.71
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.71
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.71
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.71
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.71
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.71
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.71
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.71
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.71
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.71
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.71
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.71
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.71
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.71
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.71
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.71
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.71
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.71
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.71
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.71
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.71
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.71
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.71
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.71
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.7
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.7
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.7
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.7
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.7
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.7
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.7
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.7
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.7
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.7
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.7
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.7
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.7
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.7
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.7
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.7
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.7
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.7
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.7
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.69
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.69
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.69
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.69
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.69
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.69
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.69
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.69
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.69
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.69
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.69
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.69
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.69
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.69
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.69
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.69
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.69
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.69
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.69
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.69
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.69
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 99.69
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.69
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.69
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.69
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.69
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.68
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.68
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.68
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.68
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.68
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.68
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.68
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.68
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.68
PHA03207392 serine/threonine kinase US3; Provisional 99.68
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.68
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.68
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.67
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.67
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.67
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.67
PHA03209357 serine/threonine kinase US3; Provisional 99.67
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.67
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.67
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.67
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.67
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.67
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.67
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.67
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.67
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.67
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.67
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.67
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.67
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.67
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.66
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.66
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.66
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.66
PHA02882294 putative serine/threonine kinase; Provisional 99.66
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.66
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.66
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.66
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.66
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.66
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.66
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.66
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.66
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.66
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.66
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.66
PHA03211461 serine/threonine kinase US3; Provisional 99.66
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.66
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.66
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.66
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.66
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.66
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.66
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.66
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.66
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.65
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.65
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.65
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.65
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.65
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.65
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.65
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.65
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.65
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.65
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.65
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.65
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.65
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.65
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 99.65
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.65
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.64
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.64
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.64
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.64
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.64
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.64
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.64
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.64
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.64
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.64
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.64
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.64
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.64
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.64
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.64
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.64
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.63
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.63
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.63
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.63
PRK12274218 serine/threonine protein kinase; Provisional 99.63
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.63
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.63
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.63
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.63
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.63
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.63
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.63
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.63
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.63
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.62
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.62
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.62
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.62
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.62
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.62
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.62
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.62
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.62
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.61
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.61
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.61
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.61
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.61
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.61
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.61
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.61
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.6
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.6
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.6
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.6
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.6
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.6
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.6
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.6
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.6
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.59
COG1718268 RIO1 Serine/threonine protein kinase involved in c 99.59
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.59
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.59
PLN00009294 cyclin-dependent kinase A; Provisional 99.59
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.59
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.59
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.59
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.59
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.59
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.58
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.58
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.58
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.58
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.57
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.57
KOG3653534 consensus Transforming growth factor beta/activin 99.57
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.57
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.57
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.57
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.56
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.56
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.56
COG0478304 RIO-like serine/threonine protein kinase fused to 99.56
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.56
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.55
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.55
PHA03210501 serine/threonine kinase US3; Provisional 99.55
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.55
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.54
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.54
PRK10345210 hypothetical protein; Provisional 99.54
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.53
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.53
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.53
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.53
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.53
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.53
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.52
KOG0596677 consensus Dual specificity; serine/threonine and t 99.52
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.52
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.5
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.5
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.49
PLN03224507 probable serine/threonine protein kinase; Provisio 99.49
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 99.48
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.47
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.47
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.47
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.46
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.45
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.45
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.45
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.45
KOG1167418 consensus Serine/threonine protein kinase of the C 99.44
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.43
KOG1152772 consensus Signal transduction serine/threonine kin 99.43
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.43
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.4
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.4
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.4
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.39
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.38
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.33
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.32
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.31
KOG3087229 consensus Serine/threonine protein kinase [General 99.3
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.28
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.28
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.25
KOG0584 632 consensus Serine/threonine protein kinase [General 99.25
KOG2270520 consensus Serine/threonine protein kinase involved 99.24
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.23
KOG1027903 consensus Serine/threonine protein kinase and endo 99.21
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.18
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 99.14
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.07
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 99.0
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.94
COG0515384 SPS1 Serine/threonine protein kinase [General func 98.93
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 98.85
KOG2268465 consensus Serine/threonine protein kinase [Signal 98.85
PRK10593297 hypothetical protein; Provisional 98.81
PF01636239 APH: Phosphotransferase enzyme family This family 98.81
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.8
PLN00181 793 protein SPA1-RELATED; Provisional 98.78
PRK05231319 homoserine kinase; Provisional 98.71
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 98.68
PRK09550401 mtnK methylthioribose kinase; Reviewed 98.61
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 98.61
KOG0606 1205 consensus Microtubule-associated serine/threonine 98.61
PLN02756418 S-methyl-5-thioribose kinase 98.57
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 98.57
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 98.54
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 98.52
KOG1290 590 consensus Serine/threonine protein kinase [Signal 98.5
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 98.49
PRK09902216 hypothetical protein; Provisional 98.49
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 98.44
PRK12396409 5-methylribose kinase; Reviewed 98.4
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 98.38
KOG0590601 consensus Checkpoint kinase and related serine/thr 98.38
PRK06148 1013 hypothetical protein; Provisional 98.29
COG2334331 Putative homoserine kinase type II (protein kinase 98.27
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 98.21
PLN02876 822 acyl-CoA dehydrogenase 98.21
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 98.09
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 98.09
KOG2269531 consensus Serine/threonine protein kinase [Signal 98.09
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 98.05
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 98.03
TIGR01767370 MTRK 5-methylthioribose kinase. This enzyme is inv 98.02
PLN02236344 choline kinase 98.01
PRK11768325 serine/threonine protein kinase; Provisional 98.01
COG3001286 Uncharacterized protein conserved in bacteria [Fun 97.99
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.95
PRK06149 972 hypothetical protein; Provisional 97.9
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 97.79
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.78
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 97.63
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 97.44
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 97.29
PTZ00296442 choline kinase; Provisional 97.19
PF04655253 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic r 97.12
PTZ00384383 choline kinase; Provisional 97.03
PRK10271188 thiK thiamine kinase; Provisional 96.94
KOG0590 601 consensus Checkpoint kinase and related serine/thr 96.9
PF07914414 DUF1679: Protein of unknown function (DUF1679); In 96.44
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 96.28
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 96.11
KOG3021313 consensus Predicted kinase [General function predi 95.9
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 95.83
COG4857408 Predicted kinase [General function prediction only 95.76
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 95.7
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 95.67
KOG1243 690 consensus Protein kinase [General function predict 95.51
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domai 95.31
COG0510269 ycfN Thiamine kinase and related kinases [Coenzyme 94.46
smart00146202 PI3Kc Phosphoinositide 3-kinase, catalytic domain. 94.01
TIGR02904309 spore_ysxE spore coat protein YsxE. Members of thi 93.76
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-84  Score=649.76  Aligned_cols=370  Identities=35%  Similarity=0.604  Sum_probs=357.8

Q ss_pred             CchhhHHHHHHHhcCCCCCCHHHHHHHHhhhhCCCCCChHHHHHHHHHHhCCChhhhccccCCcccccccceeeeeeeec
Q 015586            1 MGATYIKLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDPTPIASASVAQVHGARLR   80 (404)
Q Consensus         1 lG~~~iK~gQ~ls~r~dl~p~~~~~~l~~l~d~~~~~~~~~~~~~l~~~lg~~~~~~f~~~~~~pigsgs~gqVy~a~~~   80 (404)
                      |||+|||+||+||||+|++|++|+++|++|||++||+|++++++++++++|.+++++|++|+++|||+||+||||+|+++
T Consensus        68 LGPtfIK~GQ~LStR~Dl~p~e~~~eL~~LQD~vpp~~~~~~~~iie~eLG~~iee~F~eF~~~PiAsASIaQVH~A~L~  147 (517)
T COG0661          68 LGPTFIKLGQILSTRPDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLK  147 (517)
T ss_pred             hCCchhhhhhHHhcCccccCHHHHHHHHHhhcCCCCCCHHHHHHHHHHHhCCCHHHHHHHcCCCchhhhhHhhheeEEec
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEEEEecCcCcHHHHHHHHHHHHHHHHHHHHhCcccccCCHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHhhcC
Q 015586           81 GSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRRYLEAMG  160 (404)
Q Consensus        81 ~~g~~VAVKv~~p~~~~~~~~dl~~l~~~~~~~~~~~p~~~~~~~~~~~~e~~~~~~~Eld~~~Ea~n~~~~~~~~~~~~  160 (404)
                       +|+.||||||||++++.+..|+.+|+.++++++...|...++++.++++||.+.+..|+||++||+|+++++++|++  
T Consensus       148 -sG~~VAVKVqrPgi~~~i~~DL~il~~~a~~~~~~~~~~~~l~~~~vv~e~~~~l~~ElDy~~EA~n~~~~~~nf~~--  224 (517)
T COG0661         148 -SGEEVAVKVQRPGIRERIEADLKLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKD--  224 (517)
T ss_pred             -CCCEEEEEecCCChHHHHHHHHHHHHHHHHHHHHcCCccccCChHHHHHHHHHHHHHHhCHHHHHHHHHHHHHHcCC--
Confidence             89999999999999999999999999999999999988888999999999999999999999999999999999997  


Q ss_pred             CCCceEeceeeecCCCCceeEEEeecCCCCCChhhhhhcCCCHHHHHHHHHHHHHHHhhhCCccccCCCCCCeEEecCCc
Q 015586          161 LTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPENSLITALNVWFGSLLACETFHADVHAGNLWLLRDGR  240 (404)
Q Consensus       161 ~~~~v~vP~~~~~~~~~~vLVmE~i~G~~L~~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~gi~H~DlhPgNIlv~~~g~  240 (404)
                       ++.++||+|||++|+++||||||++|.++++...++..+.+...++...+..++.|++.+|+||+|||||||+++.+|+
T Consensus       225 -~~~v~VP~V~we~t~~~VLtmE~i~Gi~i~d~~~l~~~g~d~k~ia~~~~~~f~~q~~~dgffHaDpHpGNi~v~~~g~  303 (517)
T COG0661         225 -DPDVYVPKVYWEYTTRRVLTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGR  303 (517)
T ss_pred             -CCCeEeceeehhccCCcEEEEEeeCCEecccHHHHHhcCCCHHHHHHHHHHHHHHHHHhcCccccCCCccceEEecCCc
Confidence             7899999999999999999999999999999988888899999999999999999999999999999999999999999


Q ss_pred             EEEEccccccccCHHHHHHHHHHHHHHHhccHHHHHHHHHHhCCCCCcCCHHHHHHHHHHHHHHHhchhHHHHHHhhcCC
Q 015586          241 IGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDAKAFARDLEKIFSSIQELDTELVVATARGT  320 (404)
Q Consensus       241 i~LiDFG~~~~l~~~~~~~~~~~~~a~~~~d~~~~~~~~~~~g~~~~~~d~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~  320 (404)
                      ++++|||++++++++.|..+++++.++.++|+..+++.+.++|+.++..|...+..++..++..+.+             
T Consensus       304 i~~lDfGi~g~l~~~~r~~l~~~~~a~~~rD~~~v~~~~~~~G~~~~~~~~~~~~~~i~~~~~~~~~-------------  370 (517)
T COG0661         304 IVLLDFGIVGRLDPKFRRYLAELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYG-------------  370 (517)
T ss_pred             EEEEcCcceecCCHHHHHHHHHHHHHHHhhCHHHHHHHHHHhCCCCCccchHHHHHHHHHHHHhhhC-------------
Confidence            9999999999999999999999999999999999999999999999999999999999999998753             


Q ss_pred             cccccccccccccchhhHHHHHHHHHHHHhhcCcccChhHHHHHHHHHHHHHHhhhhcCCCchhhhhHHHHhhcccc
Q 015586          321 TTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLYFDRYTRLLAPNMNMLQDQRISIVSNRRN  397 (404)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~l~k~l~~leg~~~~l~p~~~~~~~~~~~~~~~~~~  397 (404)
                                .+..+.+++.++.+++.+++++++++|+++.++.|+++++||+++.+||++++++.+.|++.+..+.
T Consensus       371 ----------~~~~~~~~~~~~~~~~~~~~~~~~r~p~~l~ll~r~~~~vEg~~~~ldp~~~~~~~a~p~~~~~~~~  437 (517)
T COG0661         371 ----------KPLEEISFGEILDKLFEVARRFPMRLPPELVLLQRTLLLVEGVGRQLDPRFNLWAVAQPLLAKWLKK  437 (517)
T ss_pred             ----------CChhhccHHHHHHHHHHHHHhcCccCCHHHHHHHHHHHHHHHHHHhhCccccHHHHhhHHHHHHHHH
Confidence                      3467788999999999999999999999999999999999999999999999999999999876554

>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1236 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1234 consensus ABC (ATP binding cassette) 1 protein [General function prediction only] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>KOG2269 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>PTZ00296 choline kinase; Provisional Back     alignment and domain information
>PF04655 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic resistance kinase; InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties [] Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07914 DUF1679: Protein of unknown function (DUF1679); InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>KOG3021 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4857 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain Back     alignment and domain information
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism] Back     alignment and domain information
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain Back     alignment and domain information
>TIGR02904 spore_ysxE spore coat protein YsxE Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 49.5 bits (117), Expect = 1e-06
 Identities = 62/443 (13%), Positives = 128/443 (28%), Gaps = 150/443 (33%)

Query: 19  FPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVD----PTPIASASVAQV 74
           F   +V+ F +C D              ++D+ + I S  E                  V
Sbjct: 25  FEDAFVDNF-DCKD--------------VQDMPKSILSKEEIDHIIMSKDA--------V 61

Query: 75  HGAR-----LRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARI-LEFLNPELSRTSMVGI 128
            G       L   Q+++V K     +E+VL  +  F+   + I  E   P +     +  
Sbjct: 62  SGTLRLFWTLLSKQEEMVQKF----VEEVLRINYKFLM--SPIKTEQRQPSMMTRMYI-- 113

Query: 129 VKDIRESMLEEVD-FKKEAAN----IESFRRYLEA-----------MG------LTRQAT 166
             + R+ +  +   F K   +        R+ L             +       +     
Sbjct: 114 --EQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVC 171

Query: 167 AP---------KVY-----QHCSTRRVLTM-ERLY---GVPLTDLDSISSLVSSPENSLI 208
                      K++        S   VL M ++L        T     SS +    +S+ 
Sbjct: 172 LSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQ 231

Query: 209 TALNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIA 268
             L              +  +   L +L + +            + K W A +L    + 
Sbjct: 232 AELR---------RLLKSKPYENCLLVLLNVQ------------NAKAWNAFNLSCKILL 270

Query: 269 TEEYESMASALIEMGATDKDID--AKAFARD-LEKIFS-----SIQELDTELVVATARGT 320
           T  ++ +   L     T   +D  +     D ++ +         Q+L  E++       
Sbjct: 271 TTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVL------- 323

Query: 321 TTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREFALLLKQLLY--FDRYTRLLA 378
           TTN   +S            +  + +           R+         +   D+ T ++ 
Sbjct: 324 TTNPRRLS------------IIAESI-----------RDGLATWDNWKHVNCDKLTTIIE 360

Query: 379 PNMNMLQDQRISIVSNRRNRYRD 401
            ++N+L+       +  R  +  
Sbjct: 361 SSLNVLEP------AEYRKMFDR 377
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query404
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.96
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.95
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.95
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.95
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.95
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.94
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.94
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.93
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.93
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.93
4aoj_A329 High affinity nerve growth factor receptor; transf 99.93
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.92
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.92
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.91
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.91
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.91
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.9
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.9
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.9
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.9
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.88
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.88
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.88
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.88
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.88
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.87
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.86
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.86
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.86
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.86
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.86
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.86
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.86
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.85
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.85
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.85
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.85
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.85
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.85
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.84
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.84
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.84
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.84
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.84
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.84
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.84
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.84
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.83
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.83
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.83
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.83
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.83
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.83
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.83
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.83
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.83
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.83
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.83
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.82
3ork_A311 Serine/threonine protein kinase; structural genomi 99.82
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.82
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.82
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.82
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.82
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.82
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.82
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.82
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.82
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.82
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.82
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.82
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.82
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.82
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.81
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.81
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.81
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.81
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.81
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.81
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.81
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.81
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.81
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.81
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.81
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.81
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.81
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.81
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.81
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.8
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.8
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.8
3niz_A311 Rhodanese family protein; structural genomics, str 99.8
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.8
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.8
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.8
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.8
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.8
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.8
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.8
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.8
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.8
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.8
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.8
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.8
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.8
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.8
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.8
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.8
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.8
3bhy_A283 Death-associated protein kinase 3; death associate 99.8
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.8
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.8
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.8
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.8
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.79
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.79
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.79
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.79
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.79
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.79
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.79
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.79
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.79
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.79
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.79
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.79
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.79
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.79
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.79
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.79
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.79
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.79
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.79
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.79
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.79
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.79
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.79
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.79
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.79
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.79
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.79
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.79
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.79
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.79
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.79
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.79
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.78
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.78
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.78
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.78
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.78
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.78
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.78
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.78
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.78
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.78
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.78
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.78
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.78
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.78
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.78
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.78
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.78
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.78
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.77
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.77
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.77
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.77
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.77
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.77
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.77
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.77
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.77
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.77
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.77
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.77
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.77
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.77
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.77
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.77
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.77
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.77
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.77
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.77
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.77
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.77
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.77
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.77
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.77
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.77
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.77
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.77
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.76
3uqc_A286 Probable conserved transmembrane protein; structur 99.76
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.76
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.76
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.76
3q4u_A301 Activin receptor type-1; structural genomics conso 99.76
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.76
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.75
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.75
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.75
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.75
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.75
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.75
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.75
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.75
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.75
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.75
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.75
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.75
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.75
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.75
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.75
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.75
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.75
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.75
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.75
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.75
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.75
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.75
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.75
3soc_A322 Activin receptor type-2A; structural genomics cons 99.74
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.74
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.74
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.74
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.74
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.74
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.74
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.74
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.74
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.74
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.74
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.73
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.73
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.73
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.73
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.73
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.72
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.72
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.72
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.72
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.72
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.72
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.72
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.71
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.71
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.7
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.69
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.68
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.67
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.67
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.66
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.65
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.63
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.5
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.33
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.26
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 99.25
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 99.18
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 99.11
3r70_A320 Aminoglycoside phosphotransferase; structural geno 99.01
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 99.01
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 98.93
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.84
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 98.81
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.81
2q83_A346 YTAA protein; 2635576, structural genomics, joint 98.78
3ats_A357 Putative uncharacterized protein; hypothetical pro 98.7
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 98.63
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 98.59
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 98.55
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 98.51
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 98.5
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 98.39
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 98.38
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 98.31
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 98.29
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 98.02
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 97.88
3mes_A424 Choline kinase; malaria, structural genomics, stru 97.76
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 96.83
2x6h_A696 GH13170P, VPS34, phosphotidylinositol 3 kinase 59F 91.23
1cja_A342 Protein (actin-fragmin kinase); transferase; HET: 91.2
3ls8_A614 Phosphatidylinositol 3-kinase catalytic subunit ty 90.71
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
Probab=99.96  E-value=2.5e-30  Score=253.51  Aligned_cols=256  Identities=14%  Similarity=0.116  Sum_probs=143.2

Q ss_pred             CchhhH-HHHHHHhcCCCCCCHHHHHHHHhhhhCCCCCChHHHHHHHHHHhCCChhhhccccCC-----cccccccceee
Q 015586            1 MGATYI-KLGQFIASSPTLFPPEYVEEFQNCFDRTPAVPFGEIKRTLLEDLGRPIESVYEYVDP-----TPIASASVAQV   74 (404)
Q Consensus         1 lG~~~i-K~gQ~ls~r~dl~p~~~~~~l~~l~d~~~~~~~~~~~~~l~~~lg~~~~~~f~~~~~-----~pigsgs~gqV   74 (404)
                      ||+..+ +++|.+++.++..+ +++.+++++|+.+||.+++.+.+.++.+++.+....+..|..     ++||+|++|+|
T Consensus        32 l~~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~lg~G~~g~V  110 (365)
T 2y7j_A           32 LNREQRRAFIRSLRDDPSQSA-NLLAEAKKLNDAQPKGTENLYFQSMGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVV  110 (365)
T ss_dssp             ---------------------------------------------------CBCHHHHHHHHHHHEEEEEEEEECSSEEE
T ss_pred             chhcccccccccccCCCchhH-HHHHHHHhhhhcCCCCccccccccCCchhhcccchhhhhhhhhcccceEEecCCCEEE
Confidence            456666 88888888887766 477789999999999999999999999999888888877765     79999999999


Q ss_pred             eeeeecCCCcEEEEEecCcCcHHHHHHHHHHHHHHHHHHHHhCcccccCCHHHHHHHHHHHHHhhhcHHHHHHHHHHHHH
Q 015586           75 HGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIRESMLEEVDFKKEAANIESFRR  154 (404)
Q Consensus        75 y~a~~~~~g~~VAVKv~~p~~~~~~~~dl~~l~~~~~~~~~~~p~~~~~~~~~~~~e~~~~~~~Eld~~~Ea~n~~~~~~  154 (404)
                      |+|+++.+|+.||||+.+++.......+                          .+++.+.+.      +|...+.++. 
T Consensus       111 y~a~~~~~g~~vavK~~~~~~~~~~~~~--------------------------~~~~~~~~~------~E~~~l~~l~-  157 (365)
T 2y7j_A          111 RRCVHRATGHEFAVKIMEVTAERLSPEQ--------------------------LEEVREATR------RETHILRQVA-  157 (365)
T ss_dssp             EEEEETTTCCEEEEEEEETTSSCCCHHH--------------------------HHHHHHHHH------HHHHHHHHHT-
T ss_pred             EEEEECCCCcEEEEEEEEccccccCHHH--------------------------HHHHHHHHH------HHHHHHHHhc-
Confidence            9999987899999999987652211111                          122223333      3443444332 


Q ss_pred             HHhhcCCCCceEeceeeecCCCCceeEEEeecCCCCCChhhhhhcCCCHH--HHHHHHHHHHHHHhhhCCccccCCCCCC
Q 015586          155 YLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPE--NSLITALNVWFGSLLACETFHADVHAGN  232 (404)
Q Consensus       155 ~~~~~~~~~~v~vP~~~~~~~~~~vLVmE~i~G~~L~~~~~~~~~~~~~~--~~~~~~l~~~l~~l~~~gi~H~DlhPgN  232 (404)
                         +   ++++..+..++..++..+|||||++|++|.++.... ......  ..+...+...+.++|..|++|+||||+|
T Consensus       158 ---~---hp~iv~~~~~~~~~~~~~lv~e~~~g~~L~~~l~~~-~~l~~~~~~~i~~qi~~~L~~LH~~gi~H~Dlkp~N  230 (365)
T 2y7j_A          158 ---G---HPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEK-VALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPEN  230 (365)
T ss_dssp             ---T---CTTBCCEEEEEEBSSEEEEEECCCTTCBHHHHHHHH-SSCCHHHHHHHHHHHHHHHHHHHHTTEECSCCSGGG
T ss_pred             ---C---CCCEeEEEEEEeeCCEEEEEEEeCCCCcHHHHHHhc-CCCCHHHHHHHHHHHHHHHHHHHhCCeecCCCCHHH
Confidence               1   567777767776678889999999999998875322 122322  2344556677889999999999999999


Q ss_pred             eEEecCCcEEEEccccccccCHHHHHHHHHHHHHHHhccHHHHHHHHHHhC------CCCCcCCHHHHHHHHHHHHHH
Q 015586          233 LWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMG------ATDKDIDAKAFARDLEKIFSS  304 (404)
Q Consensus       233 Ilv~~~g~i~LiDFG~~~~l~~~~~~~~~~~~~a~~~~d~~~~~~~~~~~g------~~~~~~d~~~~~~~l~~l~~~  304 (404)
                      |+++.+|+++|+|||+++.+++.....       ...+....++..+...+      ..+...|+|+++..+++++.+
T Consensus       231 Il~~~~~~ikl~DfG~~~~~~~~~~~~-------~~~gt~~y~aPE~~~~~~~~~~~~~~~~~Di~slG~il~ell~g  301 (365)
T 2y7j_A          231 ILLDDNMQIRLSDFGFSCHLEPGEKLR-------ELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAG  301 (365)
T ss_dssp             EEECTTCCEEECCCTTCEECCTTCCBC-------CCCSCGGGCCHHHHHHTTCTTSCCBCTTHHHHHHHHHHHHHHHS
T ss_pred             EEECCCCCEEEEecCcccccCCCcccc-------cCCCCCCccChhhccccccccCcCCCchhhHHhHHHHHHHHHHC
Confidence            999999999999999998876542210       01122223333333321      244578999999999999886
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure
>2x6h_A GH13170P, VPS34, phosphotidylinositol 3 kinase 59F; transferase; 2.90A {Drosophila melanogaster} PDB: 2x6f_A 2x6i_A* 2x6j_A* 2x6k_A* Back     alignment and structure
>1cja_A Protein (actin-fragmin kinase); transferase; HET: AMP; 2.90A {Physarum polycephalum} SCOP: d.144.1.3 Back     alignment and structure
>3ls8_A Phosphatidylinositol 3-kinase catalytic subunit type 3; alpha/beta protein, PIK3C3, compound 15E, structural genomics, SGC stockholm; HET: AJZ; 2.25A {Homo sapiens} PDB: 3ihy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 404
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-04
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell division protein kinase 9, CDK9
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 39.5 bits (91), Expect = 4e-04
 Identities = 38/256 (14%), Positives = 76/256 (29%), Gaps = 7/256 (2%)

Query: 128 IVKDIRESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYG 187
            V    E     +   +E   ++  +       +    T    Y  C     L  +    
Sbjct: 42  KVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEH 101

Query: 188 VPLTDLDSISSLVSSPENSLITA-LNVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDF 246
                L ++    +  E   +   L      +   +  H D+ A N+ + RDG +   DF
Sbjct: 102 DLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADF 161

Query: 247 GIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDK-DIDAKAFA----RDLEKI 301
           G+    S    +  + +   + T  Y      L E       D+               I
Sbjct: 162 GLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPI 221

Query: 302 FSSIQELDTELVVATARGTTTNTTAVSANIVVDERQMNALFLDLLRVSESYGLKFPREFA 361
                E     +++   G+ T     + +      ++  +     +V +         +A
Sbjct: 222 MQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYA 281

Query: 362 L-LLKQLLYFDRYTRL 376
           L L+ +LL  D   R+
Sbjct: 282 LDLIDKLLVLDPAQRI 297

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query404
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.93
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.93
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.93
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.93
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.92
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.92
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.92
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.91
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.91
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.91
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.91
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.91
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.91
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.91
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.91
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.91
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.9
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.9
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.9
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.9
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.9
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.9
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.9
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.9
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.9
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.9
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.9
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.89
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.89
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.89
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.89
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.88
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.88
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.88
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.88
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.87
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.87
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.87
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.87
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.86
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.86
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.86
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.86
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.86
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.85
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.85
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.85
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.85
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.85
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.85
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.85
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.84
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.84
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.84
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.83
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.82
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.82
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.8
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.8
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.66
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 99.15
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.67
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 98.67
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.65
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 98.01
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.94
d1e7ua4369 Phoshoinositide 3-kinase (PI3K), catalytic domain 83.89
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=2e-27  Score=223.64  Aligned_cols=193  Identities=16%  Similarity=0.134  Sum_probs=132.4

Q ss_pred             hhhhccccCCcccccccceeeeeeeecCCCcEEEEEecCcCcHHHHHHHHHHHHHHHHHHHHhCcccccCCHHHHHHHHH
Q 015586           54 IESVYEYVDPTPIASASVAQVHGARLRGSQDDVVIKVLKPGIEDVLVADLNFVYVVARILEFLNPELSRTSMVGIVKDIR  133 (404)
Q Consensus        54 ~~~~f~~~~~~pigsgs~gqVy~a~~~~~g~~VAVKv~~p~~~~~~~~dl~~l~~~~~~~~~~~p~~~~~~~~~~~~e~~  133 (404)
                      +.+.|+.++  .||+|+||.||+|+.+.+|+.||||+.+..-...                          .        
T Consensus        18 p~~~Y~~~~--~iG~G~fg~Vy~a~~~~~~~~vAvK~~~~~~~~~--------------------------~--------   61 (293)
T d1yhwa1          18 PKKKYTRFE--KIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPK--------------------------K--------   61 (293)
T ss_dssp             TTTTBCSCE--ECCCSSSCEEEEEEBTTTCCEEEEEEEEGGGCSC--------------------------H--------
T ss_pred             cccccEEEE--EEecCcCcEEEEEEECCCCCEEEEEEEecccChH--------------------------H--------
Confidence            345566554  5999999999999998899999999865321000                          0        


Q ss_pred             HHHHhhhcHHHHHHHHHHHHHHHhhcCCCCceEeceeeecCCCCceeEEEeecCCCCCChhhhhhcCCCHH--HHHHHHH
Q 015586          134 ESMLEEVDFKKEAANIESFRRYLEAMGLTRQATAPKVYQHCSTRRVLTMERLYGVPLTDLDSISSLVSSPE--NSLITAL  211 (404)
Q Consensus       134 ~~~~~Eld~~~Ea~n~~~~~~~~~~~~~~~~v~vP~~~~~~~~~~vLVmE~i~G~~L~~~~~~~~~~~~~~--~~~~~~l  211 (404)
                            -.+.+|++.+.++.        ||+|.-...+....+..+|||||++|++|.++..  .......  ..+..++
T Consensus        62 ------~~~~~E~~il~~l~--------HpnIv~~~~~~~~~~~~~ivmEy~~gg~L~~~~~--~~~l~~~~~~~i~~qi  125 (293)
T d1yhwa1          62 ------ELIINEILVMRENK--------NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVT--ETCMDEGQIAAVCREC  125 (293)
T ss_dssp             ------HHHHHHHHHHHHCC--------CTTBCCEEEEEEETTEEEEEEECCTTCBHHHHHH--HSCCCHHHHHHHHHHH
T ss_pred             ------HHHHHHHHHHHhCC--------CCCEeeEeEEEEECCEEEEEEEecCCCcHHHHhh--ccCCCHHHHHHHHHHH
Confidence                  01235555554443        3443322222223556789999999999987632  2333333  3445667


Q ss_pred             HHHHHHhhhCCccccCCCCCCeEEecCCcEEEEccccccccCHHHHHHHHHHHHHHHhccHHHHHHHHHHhCCCCCcCCH
Q 015586          212 NVWFGSLLACETFHADVHAGNLWLLRDGRIGFLDFGIVGRISPKTWAAMDLFLASIATEEYESMASALIEMGATDKDIDA  291 (404)
Q Consensus       212 ~~~l~~l~~~gi~H~DlhPgNIlv~~~g~i~LiDFG~~~~l~~~~~~~~~~~~~a~~~~d~~~~~~~~~~~g~~~~~~d~  291 (404)
                      ...+.++|..|++||||||+|||++.+|+++|+|||+++.++......      ....+....++..+..-+..++.+|+
T Consensus       126 ~~aL~yLH~~~iiHrDiKp~NILl~~~~~vkl~DFG~a~~~~~~~~~~------~~~~gt~~Y~aPE~~~~~~~~~~~Di  199 (293)
T d1yhwa1         126 LQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR------STMVGTPYWMAPEVVTRKAYGPKVDI  199 (293)
T ss_dssp             HHHHHHHHHTTEECCCCSGGGEEECTTCCEEECCCTTCEECCSTTCCB------CCCCSCGGGCCHHHHSSSCBCTHHHH
T ss_pred             HHHHHHHHHCCCcccCCcHHHeEECCCCcEeeccchhheeeccccccc------cccccCCCccChhhhcCCCCCchhce
Confidence            778999999999999999999999999999999999999875432110      01124444455555554555678999


Q ss_pred             HHHHHHHHHHHHH
Q 015586          292 KAFARDLEKIFSS  304 (404)
Q Consensus       292 ~~~~~~l~~l~~~  304 (404)
                      |+++..+++|+++
T Consensus       200 wSlGvilyemltG  212 (293)
T d1yhwa1         200 WSLGIMAIEMIEG  212 (293)
T ss_dssp             HHHHHHHHHHHHS
T ss_pred             ehHhHHHHHHhhC
Confidence            9999999999987
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure