Citrus Sinensis ID: 015589


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
MKNGMIECSVCHSKLVSPTTKSISRAYDRHKTRVSSKQRVLNVFLVVGDCMLVGLQPILVYMSKVDGRFKFSPISVNFLTEMTKVLFAIVMLFFQARHQKVGEKPLLSISTFIQAARNNVLLAVPAFLYAINNYLKFIMQLYFNPATVKMLSNLKVLVIAVLLKIIMRRRFSIIQWEALALLLIGISVNQLRSLPEGSTAMGLPVAMGAYIYTLIFITVPSMASVFNEYALKSQYDTSIYLQNLFLYGYGAIFNFLGILVTAIFKGPDNLDILQGHSKATMLLIFNNAAQGILSCFFLKYADAILKKYSSTVATIFTGIASAVLFGHTLTMNFLLGISIVFISMHQFFSSLSKAKDEQQNGTHELRDVQENHRSKESFIDIAAGANEEAAHRIGSDERQPLLPT
cccccEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHECccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
******ECSVCHS***********************KQRVLNVFLVVGDCMLVGLQPILVYMSKVDGRFKFSPISVNFLTEMTKVLFAIVMLFFQARHQKVGEKPLLSISTFIQAARNNVLLAVPAFLYAINNYLKFIMQLYFNPATVKMLSNLKVLVIAVLLKIIMRRRFSIIQWEALALLLIGISVNQLRSLPE*****GLPVAMGAYIYTLIFITVPSMASVFNEYALKSQYDTSIYLQNLFLYGYGAIFNFLGILVTAIFKGPDNLDILQGHSKATMLLIFNNAAQGILSCFFLKYADAILKKYSSTVATIFTGIASAVLFGHTLTMNFLLGISIVFISMHQFFS*******************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNGMIECSVCHSKLVSPTTKSISRAYDRHKTRVSSKQRVLNVFLVVGDCMLVGLQPILVYMSKVDGRFKFSPISVNFLTEMTKVLFAIVMLFFQARHQKVGEKPLLSISTFIQAARNNVLLAVPAFLYAINNYLKFIMQLYFNPATVKMLSNLKVLVIAVLLKIIMRRRFSIIQWEALALLLIGISVNQLRSLPEGSTAMGLPVAMGAYIYTLIFITVPSMASVFNEYALKSQYDTSIYLQNLFLYGYGAIFNFLGILVTAIFKGPDNLDILQGHSKATMLLIFNNAAQGILSCFFLKYADAILKKYSSTVATIFTGIASAVLFGHTLTMNFLLGISIVFISMHQFFSSxxxxxxxxxxxxxxxxxxxxxHRSKESFIDIAAGANEEAAHRIGSDERQPLLPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CMP-sialic acid transporter 3 Sugar transporter involved in the transport of CMP-sialic acid from the cytoplasm into the Golgi.confidentQ9C5H6
CMP-sialic acid transporter 2 Sugar transporter involved in the transport of CMP-sialic acid from the cytoplasm into the Golgi.probableQ8GY97

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 123-193
View the alignment between query and template
View the model in PyMOL
Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 286-350
View the alignment between query and template
View the model in PyMOL
Template: 3B9W, chain A
Confidence level:probable
Coverage over the Query: 158-231
View the alignment between query and template
View the model in PyMOL