Citrus Sinensis ID: 015622

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400---

MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKSKVSSSGASTVSAAPANQAQTTSSAPPTSTQPTTTSQTPAPTVAPPQSVPESAPPPAAPAPAPAPAPAPAPAPAPVSSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQQGLPNMGSNAGAGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED

cEEEEEcccccEEEEEccccccHHHHHHHHHHHccccccccccEEEEEccccccccccHHHcccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHcccccccc

MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLT*******************************************************************************************VAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGI*****************************************************************FL*****FQALRTMVQAN*QILQPML*******PHLMRLIQEHQTDFLRLINEP*******************VT******EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable DNA repair protein RAD23	May be involved in nucleotide excision repair.	probable	Q40742
Putative DNA repair protein RAD23-3	May be involved in nucleotide excision repair.	probable	Q84L31
UV excision repair protein rhp23	Protects ubiquitin chains against dissambly by deubiquitinating enzymes thereby promoting protein degradation.	probable	O74803

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OQY, chain A
Confidence level:very confident
Coverage over the Query: 1-251,265-402
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 144-156
View the alignment between query and template
View the model in PyMOL