BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015643
         (403 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1M0T|A Chain A, Yeast Glutathione Synthase
 pdb|1M0T|B Chain B, Yeast Glutathione Synthase
 pdb|1M0W|A Chain A, Yeast Glutathione Synthase Bound To
           Gamma-Glutamyl-Cysteine, Amp-Pnp And 2 Magnesium Ions
 pdb|1M0W|B Chain B, Yeast Glutathione Synthase Bound To
           Gamma-Glutamyl-Cysteine, Amp-Pnp And 2 Magnesium Ions
          Length = 491

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 22/53 (41%)

Query: 87  WHQGFTRKARTPRHNNNKAMLMQQAKANEPLVPEIGCEDGSLQADDQVIDEQL 139
           W      +   P  N N  +L      NEP++ E+G     L  D+QV+  + 
Sbjct: 409 WDAYILMELIEPELNENNIILRDNKSYNEPIISELGIYGCVLFNDEQVLSNEF 461


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.134    0.425 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,882,956
Number of Sequences: 62578
Number of extensions: 481476
Number of successful extensions: 2018
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 2013
Number of HSP's gapped (non-prelim): 11
length of query: 403
length of database: 14,973,337
effective HSP length: 101
effective length of query: 302
effective length of database: 8,652,959
effective search space: 2613193618
effective search space used: 2613193618
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)