Citrus Sinensis ID: 015669


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400---
MPSQILPVTHHHRGTEAAAMLIKAEIERDDPTTSLLISSEYEDVEKAITSIKPVLSRTSSYNNNNITSPNDSPGLGNCYQQRRRRSASDNSLSSLSGSNGSGAASSAGGSRRHSFSKDVGRAAAETFLVTRLSFKLLRYLGVGYRWIVRFLALGCYSLLLLPGFIQVGCHYFFSSQVRRGIVYGDQPRNRLDLYFPKSSDGPKPVVAFITGGAWIIGYKAWGSLLGQQLSERDIIVACIDYRNFPQGTIKDMVKDASQGISFVCNNISEYGGDPDRIYLMGQSAGAHIAACTLLEQAIKETGEGESTTWSVSQIRAYFGLSGGYNLFDLVDHFHSRGLYRSIFLSIMDGEESLRQYSPEVLVQDPNTRHAVSLLPPIILFHGTADYSIPADARILQILFKELE
ccccccccccccccHHHHHHHHHHHHccccccccEEEccccHHHHHHHHcccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccCEEccccccccccccEEEECcccccccccEEEEEEcccccccccccccHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccccccccccccccccHHHHHHHHcccccHHHHccccHHHHccccccccccccccEEEEEEccccccccccHHHHHHHHHcc
********THHHRGTEAAAMLIKAEIERDDPTTSLLISSEYEDV**********************************************************************FSKDVGRAAAETFLVTRLSFKLLRYLGVGYRWIVRFLALGCYSLLLLPGFIQVGCHYFFSSQVRRGIVYGDQPRNRLDLYFPKSSDGPKPVVAFITGGAWIIGYKAWGSLLGQQLSERDIIVACIDYRNFPQGTIKDMVKDASQGISFVCNNISEYGGDPDRIYLMGQSAGAHIAACTLLEQAIKETGEGESTTWSVSQIRAYFGLSGGYNLFDLVDHFHSRGLYRSIFLSIMDGEESLRQYSPEVLVQDPNTRHAVSLLPPIILFHGTADYSIPADARILQILFKELE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSQILPVTHHHRGTEAAAMLIKAEIERDDPTTSLLISSEYEDVEKAITSIKPVLSRTSSYNNNNITSPNDSPGLGNCYQQRRRRSASDNSLSSLSGSNGSGAASSAGGSRRHSFSKDVGRAAAETFLVTRLSFKLLRYLGVGYRWIVRFLALGCYSLLLLPGFIQVGCHYFFSSQVRRGIVYGDQPRNRLDLYFPKSSDGPKPVVAFITGGAWIIGYKAWGSLLGQQLSERDIIVACIDYRNFPQGTIKDMVKDASQGISFVCNNISEYGGDPDRIYLMGQSAGAHIAACTLLEQAIKETGEGESTTWSVSQIRAYFGLSGGYNLFDLVDHFHSRGLYRSIFLSIMDGEESLRQYSPEVLVQDPNTRHAVSLLPPIILFHGTADYSIPADARILQILFKELE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2 Catalyzes the demethylation of isoprenylcysteine methylesters.probableQ5VNW5
Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 Catalyzes the demethylation of isoprenylcysteine methylesters. May be involved in the regulation of ABA signaling.probableQ8VYP9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBL, chain A
Confidence level:very confident
Coverage over the Query: 178-395
View the alignment between query and template
View the model in PyMOL
Template: 2OGT, chain A
Confidence level:very confident
Coverage over the Query: 136-168,184-297,310-325
View the alignment between query and template
View the model in PyMOL
Template: 3III, chain A
Confidence level:confident
Coverage over the Query: 177-296,311-402
View the alignment between query and template
View the model in PyMOL