Citrus Sinensis ID: 015696

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--
MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLKPLNKSKYARMVNKSK
cEEccHHHHHHHHccccccEEcccccHHHHHcccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHccccccccccEEEcccEEEccEEEccccEEEcccHHHHcccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccEEEEEcccccccccccccc
cccccHHHHHHHHHHccccccccccccccHHHHHccEEccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccccEccccEEEccEEcccccEEEEEEEEEccccccccccccccHHHcccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEcccccccEEEEEccccccccEEEccc
mfvpstegakmiftSDFANFNKGYVKSMADAvgknsllcvphesHKRIRRllsdpfsmnsLSKFVKTFDKMLSERLNKLQEsgksfsilDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAmlsfpfmipgtryyRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMlekdscptneklsdsEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADgaaltledvssmsYGLKVVKETLRMSNVllwyprvalndctidgfeikkgwhvnidaayihydpalykdpeqfnpsrfeemqksysfipfgsgprtclgmNMAKVTMLIFLHRLtsgylwtvddpdlslekkshiprlrsgcpitlkplnkskYARMVNKSK
mfvpstegakmiftSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRllsdpfsmnsLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMlsfpfmipgtryyrgIKARRRLMETFRGmiakrrsgeESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSlekkshiprlrsgcpitlkplnkskyarmvnksk
MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLKPLNKSKYARMVNKSK
**********MIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKML***********KSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMI*********************************IMDNLLTLIIAGQTTTAAAMMWSVKFLHD********************DGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKD*************KSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLS*************CPI******************
MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFR*******************MLEKDS******LSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLA**********LTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITL****************
********AKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLKPLNKSKYARMVNKSK
MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLKPLNKSKYARMVNK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLKPLNKSKYARMVNKSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query402 2.2.26 [Sep-21-2011]
Q0J185500 Abscisic acid 8'-hydroxyl no no 0.883 0.71 0.304 1e-49
A2Z212500 Abscisic acid 8'-hydroxyl N/A no 0.883 0.71 0.304 1e-49
Q9FH76463 Abscisic acid 8'-hydroxyl no no 0.920 0.799 0.297 3e-49
Q9C5Y2489 Ent-kaurenoic acid oxidas no no 0.930 0.764 0.301 1e-48
O81077482 Abscisic acid 8'-hydroxyl no no 0.957 0.798 0.308 4e-48
B5BSX1493 Beta-amyrin 11-oxidase OS N/A no 0.895 0.730 0.288 8e-46
Q50EK1493 Cytochrome P450 716B1 OS= N/A no 0.937 0.764 0.304 8e-46
Q9AXH9499 Ent-kaurenoic acid oxidas N/A no 0.957 0.771 0.287 3e-45
Q50EK0497 Cytochrome P450 716B2 OS= N/A no 0.942 0.762 0.298 5e-45
O23051490 Ent-kaurenoic acid oxidas no no 0.880 0.722 0.298 6e-45
>sp|Q0J185|ABAH3_ORYSJ Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 Back     alignment and function desciption
 Score =  197 bits (501), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/361 (30%), Positives = 186/361 (51%), Gaps = 6/361 (1%)

Query: 5   STEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKF 64
           S E A+ +  +    F   Y +S    +G ++L     + H R+R+L+  P   ++L   
Sbjct: 94  SPEAARFVLVTQAHLFKPTYPRSKERMIGPSALFFHQGDYHLRLRKLVQGPLGPDALRAL 153

Query: 65  VKTFDKMLSERLNKLQESGKSFSILDFSMKLTFD-AMCNMLMSVTDDSLLGQIEKDCTAV 123
           V   +  +   L      G   S      +L+FD  +  +     D+    ++ ++   V
Sbjct: 154 VPDVEAAVRSTLASW--DGNVSSTFHAMKRLSFDVGIVTIFGGRLDERRKAELRQNYAIV 211

Query: 124 SDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSCPTN 183
                SFP   PGT YY+ I+ARRRL      ++ +RR+  E   D L  +++  +    
Sbjct: 212 EKGYNSFPNSFPGTLYYKAIQARRRLHGVLSDIMRERRARGEPGSDLLGCLMQSRAGDDG 271

Query: 184 EKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADGA- 242
             L+D ++ DN++ ++ A Q TTA+ + W VK+LHD+ +  + +R EQ A I+   DG  
Sbjct: 272 ALLTDEQVADNIIGVLFAAQDTTASVLTWIVKYLHDHPKLLEAVRAEQ-AAIRAANDGGR 330

Query: 243 -ALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIH 301
             LT     SM+   KV+ E+LRM++++ +  R A+ D    GF I KGW V      IH
Sbjct: 331 LPLTWAQTRSMALTHKVILESLRMASIISFTFREAVADVEYKGFLIPKGWKVMPLFRNIH 390

Query: 302 YDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWT 361
           ++P  ++DP++F+PSRF+   +  +F+PFG+G   C G  +AK+ ML+ +H L +GY W 
Sbjct: 391 HNPDYFQDPQKFDPSRFKVSPRPNTFMPFGNGVHACPGNELAKLEMLVLIHHLVTGYRWE 450

Query: 362 V 362
           +
Sbjct: 451 I 451
Involved in the oxidative degradation of abscisic acid.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 9EC: 3
>sp|A2Z212|ABAH3_ORYSI Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 Back     alignment and function description
>sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 Back     alignment and function description
>sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 Back     alignment and function description
>sp|O81077|ABAH2_ARATH Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 Back     alignment and function description
>sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 Back     alignment and function description
>sp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 Back     alignment and function description
>sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 Back     alignment and function description
>sp|Q50EK0|C16B2_PICSI Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 Back     alignment and function description
>sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query402
255561050492 cytochrome P450, putative [Ricinus commu 0.972 0.794 0.785 0.0
449464578472 PREDICTED: abscisic acid 8'-hydroxylase 0.967 0.824 0.771 0.0
356561205494 PREDICTED: cytochrome P450 716B1-like [G 0.975 0.793 0.757 1e-177
359476871471 PREDICTED: abscisic acid 8'-hydroxylase 0.972 0.830 0.751 1e-176
357518225 519 Abscisic acid 8'-hydroxylase [Medicago t 0.975 0.755 0.711 1e-173
297735100426 unnamed protein product [Vitis vinifera] 0.890 0.840 0.754 1e-161
255566698491 Ent-kaurenoic acid oxidase, putative [Ri 0.972 0.796 0.655 1e-157
224062103 519 predicted protein [Populus trichocarpa] 0.975 0.755 0.473 1e-105
225458209502 PREDICTED: abscisic acid 8'-hydroxylase 0.970 0.776 0.467 1e-103
147772113496 hypothetical protein VITISV_040162 [Viti 0.970 0.786 0.467 1e-103
>gi|255561050|ref|XP_002521537.1| cytochrome P450, putative [Ricinus communis] gi|223539215|gb|EEF40808.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/391 (78%), Positives = 348/391 (89%)

Query: 1   MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNS 60
           +FVPS EGA+ IF +DF +FNKGYVKSMADAVG+ SLLCVPH+SHKRIR LLS+PFSM S
Sbjct: 102 VFVPSPEGARKIFANDFVDFNKGYVKSMADAVGEKSLLCVPHDSHKRIRHLLSEPFSMPS 161

Query: 61  LSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDC 120
           LSKFV+ FD+ML+  L KL+ESGK F++LDFSMK+TFDAMCNMLMSVT+DSLL  IEKDC
Sbjct: 162 LSKFVQKFDQMLAWELKKLEESGKCFTVLDFSMKMTFDAMCNMLMSVTEDSLLRGIEKDC 221

Query: 121 TAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSC 180
           TA+SD+MLS P MIPGTRYY+GIKAR+RLMET +G+I KRRS   S EDFLQSML++DS 
Sbjct: 222 TAISDSMLSIPLMIPGTRYYQGIKARQRLMETLKGIIDKRRSEMGSDEDFLQSMLQRDSY 281

Query: 181 PTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKAD 240
           P++EKL DSEIMDNLLTLIIAGQTTTAAA+MWSV FLH N+EAQ +LREEQL++ K K D
Sbjct: 282 PSDEKLDDSEIMDNLLTLIIAGQTTTAAALMWSVMFLHQNQEAQTRLREEQLSIAKHKQD 341

Query: 241 GAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYI 300
           GA+L+LED++ MSYGLKV KETLRMSNVLLW+PRVALNDCTIDGFEIKKGWHVNIDA  I
Sbjct: 342 GASLSLEDLNKMSYGLKVAKETLRMSNVLLWFPRVALNDCTIDGFEIKKGWHVNIDATCI 401

Query: 301 HYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLW 360
           HYDPA YKDPE FNPSRF+EMQK YSF+PFGSGPRTCLGMNMAKVTML+FLHRLTSGY W
Sbjct: 402 HYDPAFYKDPELFNPSRFDEMQKPYSFVPFGSGPRTCLGMNMAKVTMLVFLHRLTSGYKW 461

Query: 361 TVDDPDLSLEKKSHIPRLRSGCPITLKPLNK 391
            + D D SLEKK+HIPRLRSGCPITL+ LNK
Sbjct: 462 NIHDLDPSLEKKAHIPRLRSGCPITLEALNK 492

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449464578|ref|XP_004150006.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus] gi|449520849|ref|XP_004167445.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356561205|ref|XP_003548874.1| PREDICTED: cytochrome P450 716B1-like [Glycine max] Back     alignment and taxonomy information
>gi|359476871|ref|XP_002269279.2| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357518225|ref|XP_003629401.1| Abscisic acid 8'-hydroxylase [Medicago truncatula] gi|355523423|gb|AET03877.1| Abscisic acid 8'-hydroxylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297735100|emb|CBI17462.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255566698|ref|XP_002524333.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis] gi|223536424|gb|EEF38073.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224062103|ref|XP_002300756.1| predicted protein [Populus trichocarpa] gi|222842482|gb|EEE80029.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458209|ref|XP_002281158.1| PREDICTED: abscisic acid 8'-hydroxylase 4 [Vitis vinifera] gi|302142529|emb|CBI19732.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147772113|emb|CAN64558.1| hypothetical protein VITISV_040162 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query402
TAIR|locus:2013159476 CYP722A1 ""cytochrome P450, fa 0.947 0.800 0.443 3.3e-86
TAIR|locus:2062623489 KAO2 "ent-kaurenoic acid hydro 0.930 0.764 0.301 5.4e-47
TAIR|locus:2066138482 CYP707A2 ""cytochrome P450, fa 0.957 0.798 0.311 6.9e-47
TAIR|locus:2158480463 CYP707A3 ""cytochrome P450, fa 0.937 0.814 0.293 8.8e-47
TAIR|locus:2207240490 CYP88A3 ""cytochrome P450, fam 0.900 0.738 0.295 1.5e-44
UNIPROTKB|Q5VRM7506 OSJNBa0004I20.18 "Putative cyt 0.935 0.743 0.294 1.9e-44
UNIPROTKB|Q8GSQ1469 CYP85A1 "Cytochrome P450 85A1" 0.855 0.733 0.323 1e-43
TAIR|locus:2166439472 CPD "CONSTITUTIVE PHOTOMORPHOG 0.898 0.764 0.314 1.3e-43
TAIR|locus:2094058468 CYP707A4 ""cytochrome P450, fa 0.950 0.816 0.282 5.7e-43
TAIR|locus:2134781484 CYP707A1 ""cytochrome P450, fa 0.865 0.719 0.296 7.3e-43
TAIR|locus:2013159 CYP722A1 ""cytochrome P450, family 722, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 862 (308.5 bits), Expect = 3.3e-86, P = 3.3e-86
 Identities = 172/388 (44%), Positives = 252/388 (64%)

Query:     1 MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNS 60
             +F+ +TE A+++  +D   F K Y+KS+ + VG  SLLC P   HK +R  L + FS  S
Sbjct:    86 VFLSTTESARLVLNNDSGMFTKRYIKSIGELVGDRSLLCAPQHHHKILRSRLINLFSKRS 145

Query:    61 LSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDC 120
              +  V+ FD+++ + L   +  G    + D  +++TF AMC ML+S+  +  LG +++D 
Sbjct:   146 TALMVRHFDELVVDALGGWEHRGTVVLLTDL-LQITFKAMCKMLVSLEKEEELGSMQRDV 204

Query:   121 TAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRR----SGEESFEDFLQSMLE 176
               V +AML+FP  +P TR+++GI AR R+ME    +I +RR    S     EDFLQ +L 
Sbjct:   205 GFVCEAMLAFPLNLPWTRFHKGIMARGRVMEMLEKIIRERRNEINSHNNHHEDFLQQLLA 264

Query:   177 KDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIK 236
              D+     +L+D+EI DN+LT+IIAGQ TTA+A+ W VK+L +N++    L EEQ  + K
Sbjct:   265 VDN--DTPQLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLDILIEEQSQITK 322

Query:   237 DKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNID 296
               ++   L LED+S M Y  K+VKE+LRM++V+ W+PR+ L DC ++G++IKKGW++NID
Sbjct:   323 KASNKPFLELEDLSEMPYASKMVKESLRMASVVPWFPRLVLQDCEMEGYKIKKGWNINID 382

Query:   297 AAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTS 356
             A  IH DP +Y +P +FNP RFEE  K+ SF+ FG G RTCLG+ +AK  ML+FLHR  +
Sbjct:   383 ARSIHLDPTVYSEPHKFNPLRFEEEAKANSFLAFGMGGRTCLGLALAKAMMLVFLHRFIT 442

Query:   357 GYLWTVDDPDLSLEKKSHIPRLRSGCPI 384
              Y W V D D S+EK +   RL+SG PI
Sbjct:   443 TYRWEVVDEDPSIEKWTLFARLKSGYPI 470
GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2062623 KAO2 "ent-kaurenoic acid hydroxylase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066138 CYP707A2 ""cytochrome P450, family 707, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158480 CYP707A3 ""cytochrome P450, family 707, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207240 CYP88A3 ""cytochrome P450, family 88, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRM7 OSJNBa0004I20.18 "Putative cytochrome P450 DWARF3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GSQ1 CYP85A1 "Cytochrome P450 85A1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2166439 CPD "CONSTITUTIVE PHOTOMORPHOGENIC DWARF" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094058 CYP707A4 ""cytochrome P450, family 707, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134781 CYP707A1 ""cytochrome P450, family 707, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-71
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 2e-58
pfam00067461 pfam00067, p450, Cytochrome P450 3e-58
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-55
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 9e-54
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 6e-53
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 1e-51
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 5e-44
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 3e-26
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 2e-25
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-22
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 5e-21
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 9e-21
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 5e-20
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 1e-19
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-19
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-19
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-17
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-16
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-15
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-14
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-13
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 5e-13
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 6e-12
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 7e-10
PLN02648480 PLN02648, PLN02648, allene oxide synthase 2e-06
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 0.003
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information 
 Score =  232 bits (593), Expect = 1e-71
 Identities = 121/395 (30%), Positives = 206/395 (52%), Gaps = 14/395 (3%)

Query: 2   FVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFS-MNS 60
            V + E  K + T D   F  G+ +S  + +G+ S + +  E HKR+RRL + P +   +
Sbjct: 96  LVTTPEACKRVLTDD-DAFEPGWPESTVELIGRKSFVGITGEEHKRLRRLTAAPVNGPEA 154

Query: 61  LSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDC 120
           LS ++   ++ +   L K  + G+    L    KLTF  +  + +S   + ++  +E++ 
Sbjct: 155 LSTYIPYIEENVKSCLEKWSKMGE-IEFLTELRKLTFKIIMYIFLSSESELVMEALEREY 213

Query: 121 TAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFE-----DFLQSML 175
           T ++  + +    +PG  Y+R +KAR++L+  F+ ++ +RR+  +        D L  +L
Sbjct: 214 TTLNYGVRAMAINLPGFAYHRALKARKKLVALFQSIVDERRNSRKQNISPRKKDMLDLLL 273

Query: 176 E-KDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAM 234
           + +D      KL D EI+D LL  + AG  ++    MW+  FL ++ E  QK + EQ  +
Sbjct: 274 DAEDE--NGRKLDDEEIIDLLLMYLNAGHESSGHLTMWATIFLQEHPEVLQKAKAEQEEI 331

Query: 235 IKDKADG-AALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHV 293
            K +  G   LTL+DV  M Y  +V+ ETLR+ N+ L   R A  D  ++G+ I KGW V
Sbjct: 332 AKKRPPGQKGLTLKDVRKMEYLSQVIDETLRLINISLTVFREAKTDVEVNGYTIPKGWKV 391

Query: 294 NIDAAYIHYDPALYKDPEQFNPSRFE-EMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLH 352
                 +H DP +Y +P++F+PSR++    K+ +F+PFG G R C G ++AK+ + IFLH
Sbjct: 392 LAWFRQVHMDPEVYPNPKEFDPSRWDNYTPKAGTFLPFGLGSRLCPGNDLAKLEISIFLH 451

Query: 353 RLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLK 387
               GY     +P   +    H PR +  C   + 
Sbjct: 452 HFLLGYRLERLNPGCKVMYLPH-PRPKDNCLARIT 485

Length = 490
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 402
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
PF1255448 MOZART1: Mitotic-spindle organizing gamma-tubulin 81.62
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-71  Score=502.78  Aligned_cols=387  Identities=26%  Similarity=0.401  Sum_probs=311.7

Q ss_pred             CccCChHHHhHhhhccccccccc--hhhhHHh-hhCCCCccccCChhHHHHHHhhcCCCChHHHHHHHHHHHHHHHHHHH
Q 015696            1 MFVPSTEGAKMIFTSDFANFNKG--YVKSMAD-AVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLN   77 (402)
Q Consensus         1 Vvv~~~~~i~~vl~~~~~~f~~~--~~~~~~~-~~g~~~l~~~~g~~~~~~R~~l~~~fs~~~l~~~~~~~~~~~~~~l~   77 (402)
                      ++|+||+.|++|+.++.+.|..+  +...-.. -++..+++..+|+.||++|..++|.|++.+++.+.+.+.+...++++
T Consensus        79 l~v~D~elik~I~ik~F~~F~~r~~~~~~d~~~~l~~~~Lf~~~g~~WK~lR~~lsP~Fts~kmk~m~~t~~~~~~~l~~  158 (499)
T KOG0158|consen   79 LLVSDPELIKEILIKDFDNFYNRKRPIYGDPEDPLSALNLFFLRGERWKRLRTKLSPTFTSGKLKKMFPTMEEVGDELVR  158 (499)
T ss_pred             eEecCHHHHHHHHHHhCccCcCCCCCCcCCCCCcccccCchhccCchHHHHHHhhccccchhhHHHHHHHHHHHHHHHHH
Confidence            57999999999999999999984  2211111 23335688999999999999999999999999999999999988888


Q ss_pred             HHhhcC---CceeHHHHHHHHHHHHHHHHhcCCCCchhh---HHHHHHHHHHhcc-ccccc------cccCchh-----h
Q 015696           78 KLQESG---KSFSILDFSMKLTFDAMCNMLMSVTDDSLL---GQIEKDCTAVSDA-MLSFP------FMIPGTR-----Y  139 (402)
Q Consensus        78 ~l~~~~---~~v~~~~~~~~~~~~~i~~~~fG~~~~~~~---~~~~~~~~~~~~~-~~~~~------~~~p~~~-----~  139 (402)
                      .+.+..   ..+++.+.+..+++|+|++++||....+..   ..+.......... ....+      +.+|...     .
T Consensus       159 ~l~~~~~~~~~~~~~dl~~~yT~DVI~~~AfG~~~~s~~d~~~~F~~~~~~~~~~~~~~~~l~~~~~~~~p~l~~~l~~~  238 (499)
T KOG0158|consen  159 HLRRKSEGGQEGEIKDLCARYTTDVIGSCAFGLDANSLRDPKAEFRRMGRRAFFLSRGLFPLKFMLIFLFPKLALPLRVK  238 (499)
T ss_pred             HHHHhhcccCCccHHHHHHHHHHHHHhHhhcccchhhhcCchHHHHHhhHHHHHHhhccchHhHhHHHHhHHHHHhhhcc
Confidence            886432   378999999999999999999999855432   2222211111111 00111      0111110     0


Q ss_pred             hhhHHHHHHHHHHHHHHHHHHhcCCCchHHHHHHhhccCCC---CC-CC-CCCHHHHHHHHHHHHHhchhhHHHHHHHHH
Q 015696          140 YRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSC---PT-NE-KLSDSEIMDNLLTLIIAGQTTTAAAMMWSV  214 (402)
Q Consensus       140 ~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~l~~ll~~~~~---~~-~~-~l~~~~i~~~~~~~~~ag~~tt~~~l~~~l  214 (402)
                      .........+.+.+.+.++.|..++..+.|+++.+++.+..   +. .. .+|.++++++++.+++||.||||+++++++
T Consensus       239 ~~~~~~~~~~~~~v~~~v~~R~~~~~~r~Dfi~lll~~~~~~~~~~~~~~~lt~dei~aQafvFl~AGfeTts~tlsf~l  318 (499)
T KOG0158|consen  239 LFPEDVTDFFRKLVNSRVEQREKENIERNDFIDLLLDARASDFAKSKSHKALTDDEIAAQAFVFLLAGFETTASTLSFAL  318 (499)
T ss_pred             cChHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHhhcccccccccccccCHHHHHHHHHHHHHhhhHhHHHHHHHHH
Confidence            11223445566777777887766667788999999987642   11 11 599999999999999999999999999999


Q ss_pred             HHHhhCHHHHHHHHHHHHHHHhccCCCCCCCHHhhcCCchHHHHHHHhhcCcccccCccceecccceec-CEEeCCCCEE
Q 015696          215 KFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTID-GFEIKKGWHV  293 (402)
Q Consensus       215 ~~l~~~pe~q~~l~~Ei~~~~~~~~~~~~~~~~~~~~l~~l~a~i~E~lRl~p~~~~~~R~~~~d~~~~-g~~ip~g~~v  293 (402)
                      |+||+|||+|+|+|+||+++....   ..+++|.+.+|+||++||+||||+||++|.+.|.|++|++++ ++.||||+.|
T Consensus       319 YeLA~~PdvQ~kLreEI~~~~~~~---~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~~i~~~~~i~kG~~V  395 (499)
T KOG0158|consen  319 YELAKNPDVQDKLREEIDEVLEEK---EGLTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDYEIPGGFVIPKGTPV  395 (499)
T ss_pred             HHHhcChHHHHHHHHHHHHHhccc---CCCCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCceecCCCeEeCCCCEE
Confidence            999999999999999999997432   239999999999999999999999999999999999999999 9999999999


Q ss_pred             eecchhhhcCCCCCCCCCCCCCCCCCCCC----CCCcccccCCCCCCCcchHHHHHHHHHHHHHHHhcceeeecCCCCcc
Q 015696          294 NIDAAYIHYDPALYKDPEQFNPSRFEEMQ----KSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSL  369 (402)
Q Consensus       294 ~~~~~~~~~d~~~~~~p~~F~P~R~l~~~----~~~~~~~Fg~G~r~C~G~~la~~~~~~~l~~ll~~f~~~~~~~~~~~  369 (402)
                      .++.+++||||++||||++|+||||.+++    .+..|+|||.|||.|+|.+||.+|+|++|++||++|+++..+.....
T Consensus       396 ~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~f~~~~~~~t~~~  475 (499)
T KOG0158|consen  396 MIPTYALHHDPEYWPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLRNFSFEVCPTTIIP  475 (499)
T ss_pred             EeecccccCCcccCCCcccCCCccCCCCcccccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHhhCEEecCCcccCc
Confidence            99999999999999999999999999754    57899999999999999999999999999999999999997632222


Q ss_pred             cc---ccccccCCCCcceEEEeCC
Q 015696          370 EK---KSHIPRLRSGCPITLKPLN  390 (402)
Q Consensus       370 ~~---~~~~~~~~~~~~v~~~~~~  390 (402)
                      ..   ...++.|++|+++++++|.
T Consensus       476 ~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  476 LEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             ccCCccceeeecCCceEEEEEeCC
Confidence            22   2446889999999999884

>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PF12554 MOZART1: Mitotic-spindle organizing gamma-tubulin ring associated; InterPro: IPR022214 This family of proteins is found in eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-33
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-28
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-28
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 2e-28
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 7e-22
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 7e-20
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 1e-19
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 5e-17
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 7e-17
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 1e-16
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 1e-16
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 3e-16
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 3e-16
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-16
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 3e-16
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 3e-16
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 3e-16
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 3e-16
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-16
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 3e-16
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 3e-16
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 4e-16
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 4e-16
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 4e-16
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 4e-16
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 7e-16
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-16
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 8e-16
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 8e-16
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 9e-16
1fah_A471 Structure Of Cytochrome P450 Length = 471 1e-15
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-15
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-15
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-15
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 1e-15
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 1e-15
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 1e-15
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-15
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 1e-15
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 1e-15
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-15
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 1e-15
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-15
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 1e-15
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 2e-15
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-15
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-15
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-15
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 6e-15
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 8e-15
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 8e-15
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-14
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-14
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 6e-14
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-13
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-13
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 3e-13
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-13
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 4e-13
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 4e-13
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 4e-13
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 5e-13
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 1e-12
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 1e-12
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 1e-12
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 1e-12
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 1e-12
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 2e-12
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 2e-12
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 2e-12
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 2e-12
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-12
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-12
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-12
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 5e-12
1ued_A406 Crystal Structure Of Oxyc A Cytochrome P450 Implica 8e-12
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-11
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 1e-11
3e5l_A403 Crystal Structure Of Cyp105p1 H72a Mutant Length = 1e-10
3e5j_A403 Crystal Structure Of Cyp105p1 Wild-type Ligand-free 1e-10
3aba_A403 Crystal Structure Of Cyp105p1 In Complex With Filip 1e-10
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 1e-10
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 1e-10
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 2e-10
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 2e-10
1cpt_A428 Crystal Structure And Refinement Of Cytochrome P450 2e-10
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 3e-10
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-10
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 5e-10
1lfk_A398 Crystal Structure Of Oxyb, A Cytochrome P450 Implic 6e-10
4apy_A433 Ethylene Glycol-bound Form Of P450 Cyp125a3 From My 8e-10
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-09
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 2e-09
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-09
1odo_A408 1.85 A Structure Of Cyp154a1 From Streptomyces Coel 3e-09
1egy_A403 Cytochrome P450eryf With 9-Aminophenanthrene Bound 1e-08
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-08
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 1e-08
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-08
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 1e-08
1z8q_A404 Ferrous Dioxygen Complex Of The A245t Cytochrome P4 1e-08
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 1e-08
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 1e-08
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 3e-08
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 3e-08
1jip_A403 P450eryf(A245s)KETOCONAZOLE Length = 403 4e-08
1z8p_A404 Ferrous Dioxygen Complex Of The A245s Cytochrome P4 4e-08
1z8o_A404 Ferrous Dioxygen Complex Of The Wild-Type Cytochrom 4e-08
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 4e-08
1jio_A403 P450eryf/6deb Length = 403 4e-08
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 5e-08
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 9e-08
2x5l_A431 X-Ray Structure Of The Substrate-Free Mycobacterium 1e-07
2xn8_A423 X-Ray Structure Of The Substrate-Free Mycobacterium 1e-07
2xc3_A424 X-Ray Structure Of Mycobacterium Tuberculosis Cyp12 1e-07
2x5w_A440 X-Ray Structure Of Mycobacterium Tuberculosis Cytoc 1e-07
3ivy_A433 Crystal Structure Of Mycobacterium Tuberculosis Cyt 2e-07
2yoo_A407 Cholest-4-en-3-one Bound Structure Of Cyp142 From M 2e-07
3abb_A408 Crystal Structure Of Cyp105d6 Length = 408 3e-07
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 3e-07
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 3e-07
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 3e-07
3pm0_A507 Structural Characterization Of The Complex Between 4e-07
3tkt_A450 Crystal Structure Of Cyp108d1 From Novosphingobium 4e-07
3cv9_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-07
2zby_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-07
3cv8_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-07
2zbx_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-07
2z36_A413 Crystal Structure Of Cytochrome P450 Moxa From Nono 7e-07
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 1e-06
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 1e-06
2y46_A417 Structure Of The Mixed-Function P450 Mycg In Comple 2e-06
2wgy_A413 Crystal Structure Of The G243a Mutant Of Cyp130 Fro 3e-06
4aw3_A417 Structure Of The Mixed-Function P450 Mycg F286v Mut 3e-06
3tyw_A417 Crystal Structure Of Cyp105n1 From Streptomyces Coe 4e-06
3zsn_A417 Structure Of The Mixed-Function P450 Mycg F286a Mut 5e-06
2uuq_A414 Crystal Structure Of Cyp130 From Mycobacterium Tube 6e-06
2wh8_A413 Interaction Of Mycobacterium Tuberculosis Cyp130 Wi 6e-06
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 9e-06
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 9e-06
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 9e-06
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 9e-06
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 9e-06
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 1e-05
3rwl_A426 Structure Of P450pyr Hydroxylase Length = 426 3e-05
3a4g_A411 Structure Of Cytochrome P450 Vdh From Pseudonocardi 7e-05
2z3t_A425 Crystal Structure Of Substrate Free Cytochrome P450 9e-05
3ofu_A396 Crystal Structure Of Cytochrome P450 Cyp101c1 Lengt 1e-04
1pkf_A419 Crystal Structure Of Epothilone D-Bound Cytochrome 1e-04
3a4z_A411 Structure Of Cytochrome P450 Vdh Mutant (Vdh-K1) Ob 1e-04
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 1e-04
1q5d_A419 Epothilone B-Bound Cytochrome P450epok Length = 419 1e-04
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 1e-04
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 1e-04
4ep6_A392 Crystal Structure Of The Xpla Heme Domain In Comple 2e-04
2wiv_A394 Cytochrome-P450 Xpla Heme Domain P21 Length = 394 2e-04
3tnk_A407 Crystal Structure Of Mutant I87r In Cyp158a2 Length 2e-04
1se6_A406 Crystal Structure Of Streptomyces Coelicolor A3(2) 2e-04
3tzo_A410 The Role Of I87 Of Cyp158a2 In Oxidative Coupling R 2e-04
1t93_A406 Evidence For Multiple Substrate Recognition And Mol 2e-04
2d09_A407 A Role For Active Site Water Molecules And Hydroxyl 2e-04
2d0e_A407 Substrate Assited In Oxygen Activation In Cytochrom 2e-04
1s1f_A406 Crystal Structure Of Streptomyces Coelicolor A3(2) 2e-04
2xkr_A398 Crystal Structure Of Mycobacterium Tuberculosis Cyp 2e-04
1gwi_A411 The 1.92 A Structure Of Streptomyces Coelicolor A3( 5e-04
2rfb_A343 Crystal Structure Of A Cytochrome P450 From The The 6e-04
3dam_A473 Crystal Structure Of Allene Oxide Synthase Length = 7e-04
2wm4_A435 X-Ray Structure Of Mycobacterium Tuberculosis Cytoc 8e-04
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure 
Iteration: 1

 Score =  140 bits (353), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 99/372 (26%), Positives = 171/372 (45%), Gaps = 22/372 (5%)
Query: 1   MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNS 60
           +F+      + +FT +   F   +  S    +G N+L     E H+  R++L   F   +
Sbjct: 57  IFISGALANRFLFTKEQETFQATWPLSTRILLGPNALATQMGEIHRSRRKILYQAFLPRT 116
Query: 61  LSKFVKTFDKMLSERLNKLQESGKSFSILDFSM--KLTFDAMCNMLMS--VTDDSLLGQI 116
           L  ++   D ++      L++ GK+  ++ +    ++TFD    + M   V+ +    Q+
Sbjct: 117 LDSYLPKMDGIVQ---GYLEQWGKANEVIWYPQLRRMTFDVAATLFMGEKVSQNP---QL 170
Query: 117 EKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLE 176
                     + S P  +P T + +  +AR  L+     +I  R+    S ED L  +L 
Sbjct: 171 FPWFETYIQGLFSLPIPLPNTLFGKSQRARALLLAELEKIIKARQQQPPSEEDALGILLA 230
Query: 177 -KDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMI 235
            +D    N+ LS  E+ D +L L+ AG  T  +A+      L  + + ++++R+EQ  + 
Sbjct: 231 ARDD--NNQPLSLPELKDQILLLLFAGHETLTSALSSFCLLLGQHSDIRERVRQEQNKLQ 288
Query: 236 KDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNI 295
             +     LT E +  M Y  +V++E LR+   +    R  + DC   GF   KGW V+ 
Sbjct: 289 LSQE----LTAETLKKMPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSY 344
Query: 296 DAAYIHYDPALYKDPEQFNPSRFEE-----MQKSYSFIPFGSGPRTCLGMNMAKVTMLIF 350
             +  H DP LY DPE+F+P RF           ++ +PFG G R CLG   A++ M +F
Sbjct: 345 QISQTHADPDLYPDPEKFDPERFTPDGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLF 404
Query: 351 LHRLTSGYLWTV 362
             RL   + WT+
Sbjct: 405 ATRLIQQFDWTL 416
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1UED|A Chain A, Crystal Structure Of Oxyc A Cytochrome P450 Implicated In An Oxidative C-C Coupling Reaction During Vancomycin Biosynthesis. Length = 406 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3E5L|A Chain A, Crystal Structure Of Cyp105p1 H72a Mutant Length = 403 Back     alignment and structure
>pdb|3E5J|A Chain A, Crystal Structure Of Cyp105p1 Wild-type Ligand-free Form Length = 403 Back     alignment and structure
>pdb|3ABA|A Chain A, Crystal Structure Of Cyp105p1 In Complex With Filipin I Length = 403 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1LFK|A Chain A, Crystal Structure Of Oxyb, A Cytochrome P450 Implicated In An Oxidative Phenol Coupling Reaction During Vancomycin Biosynthesis Length = 398 Back     alignment and structure
>pdb|4APY|A Chain A, Ethylene Glycol-bound Form Of P450 Cyp125a3 From Mycobacterium Smegmatis Length = 433 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1ODO|A Chain A, 1.85 A Structure Of Cyp154a1 From Streptomyces Coelicolor A3(2) Length = 408 Back     alignment and structure
>pdb|1EGY|A Chain A, Cytochrome P450eryf With 9-Aminophenanthrene Bound Length = 403 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE Length = 403 Back     alignment and structure
>pdb|1Z8P|A Chain A, Ferrous Dioxygen Complex Of The A245s Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1Z8O|A Chain A, Ferrous Dioxygen Complex Of The Wild-Type Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|1JIO|A Chain A, P450eryf/6deb Length = 403 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|2X5L|A Chain A, X-Ray Structure Of The Substrate-Free Mycobacterium Tuberculosis Cytochrome P450 Cyp125, Alternative Crystal Form Length = 431 Back     alignment and structure
>pdb|2XN8|A Chain A, X-Ray Structure Of The Substrate-Free Mycobacterium Tuberculosis Cytochrome P450 Cyp125 Length = 423 Back     alignment and structure
>pdb|2XC3|A Chain A, X-Ray Structure Of Mycobacterium Tuberculosis Cyp125 Bound To The Reverse Type I Inhibitor Length = 424 Back     alignment and structure
>pdb|2X5W|A Chain A, X-Ray Structure Of Mycobacterium Tuberculosis Cytochrome P450 Cyp125 In Complex With Substrate Cholest-4-En-3-One Length = 440 Back     alignment and structure
>pdb|3IVY|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cytochrome P450 Cyp125, P212121 Crystal Form Length = 433 Back     alignment and structure
>pdb|2YOO|A Chain A, Cholest-4-en-3-one Bound Structure Of Cyp142 From Mycobacterium Smegmatis Length = 407 Back     alignment and structure
>pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3TKT|A Chain A, Crystal Structure Of Cyp108d1 From Novosphingobium Aromaticivorans Dsm12444 Length = 450 Back     alignment and structure
>pdb|3CV9|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R73aR84A MUTANT) IN COMPLEX WITH 1ALPHA,25- Dihydroxyvitamin D3 Length = 412 Back     alignment and structure
>pdb|2ZBY|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84a Mutant) Length = 412 Back     alignment and structure
>pdb|3CV8|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84f Mutant) Length = 412 Back     alignment and structure
>pdb|2ZBX|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (Wild Type) With Imidazole Bound Length = 412 Back     alignment and structure
>pdb|2Z36|A Chain A, Crystal Structure Of Cytochrome P450 Moxa From Nonomuraea Recticatena (Cyp105) Length = 413 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|2Y46|A Chain A, Structure Of The Mixed-Function P450 Mycg In Complex With Mycinamicin Iv In C 2 2 21 Space Group Length = 417 Back     alignment and structure
>pdb|2WGY|A Chain A, Crystal Structure Of The G243a Mutant Of Cyp130 From M. Tuberculosis Length = 413 Back     alignment and structure
>pdb|4AW3|A Chain A, Structure Of The Mixed-Function P450 Mycg F286v Mutant In Complex With Mycinamicin V In P1 Space Group Length = 417 Back     alignment and structure
>pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 Back     alignment and structure
>pdb|3ZSN|A Chain A, Structure Of The Mixed-Function P450 Mycg F286a Mutant In Complex With Mycinamicin Iv Length = 417 Back     alignment and structure
>pdb|2UUQ|A Chain A, Crystal Structure Of Cyp130 From Mycobacterium Tuberculosis In The Ligand-Free Form Length = 414 Back     alignment and structure
>pdb|2WH8|A Chain A, Interaction Of Mycobacterium Tuberculosis Cyp130 With Heterocyclic Arylamines Length = 413 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|3RWL|A Chain A, Structure Of P450pyr Hydroxylase Length = 426 Back     alignment and structure
>pdb|3A4G|A Chain A, Structure Of Cytochrome P450 Vdh From Pseudonocardia Autotrophica (Trigonal Crystal Form) Length = 411 Back     alignment and structure
>pdb|2Z3T|A Chain A, Crystal Structure Of Substrate Free Cytochrome P450 Stap (cyp245a1) Length = 425 Back     alignment and structure
>pdb|3OFU|A Chain A, Crystal Structure Of Cytochrome P450 Cyp101c1 Length = 396 Back     alignment and structure
>pdb|1PKF|A Chain A, Crystal Structure Of Epothilone D-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|3A4Z|A Chain A, Structure Of Cytochrome P450 Vdh Mutant (Vdh-K1) Obtained By Directed Evolution Length = 411 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|1Q5D|A Chain A, Epothilone B-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|4EP6|A Chain A, Crystal Structure Of The Xpla Heme Domain In Complex With Imidazole And Peg Length = 392 Back     alignment and structure
>pdb|2WIV|A Chain A, Cytochrome-P450 Xpla Heme Domain P21 Length = 394 Back     alignment and structure
>pdb|3TNK|A Chain A, Crystal Structure Of Mutant I87r In Cyp158a2 Length = 407 Back     alignment and structure
>pdb|1SE6|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 Back     alignment and structure
>pdb|3TZO|A Chain A, The Role Of I87 Of Cyp158a2 In Oxidative Coupling Reaction Length = 410 Back     alignment and structure
>pdb|1T93|A Chain A, Evidence For Multiple Substrate Recognition And Molecular Mechanism Of C-C Reaction By Cytochrome P450 Cyp158a2 From Streptomyces Coelicolor A3(2) Length = 406 Back     alignment and structure
>pdb|2D09|A Chain A, A Role For Active Site Water Molecules And Hydroxyl Groups Of Substrate For Oxygen Activation In Cytochrome P450 158a2 Length = 407 Back     alignment and structure
>pdb|2D0E|A Chain A, Substrate Assited In Oxygen Activation In Cytochrome P450 158a2 Length = 407 Back     alignment and structure
>pdb|1S1F|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 Back     alignment and structure
>pdb|2XKR|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cyp142: A Novel Cholesterol Oxidase Length = 398 Back     alignment and structure
>pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 Back     alignment and structure
>pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 Back     alignment and structure
>pdb|3DAM|A Chain A, Crystal Structure Of Allene Oxide Synthase Length = 473 Back     alignment and structure
>pdb|2WM4|A Chain A, X-Ray Structure Of Mycobacterium Tuberculosis Cytochrome P450 Cyp124 In Complex With Phytanic Acid Length = 435 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-133
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-97
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 8e-95
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 9e-95
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-89
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-86
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 9e-80
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-79
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-74
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-71
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 7e-69
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-66
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-62
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-56
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-56
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-54
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-53
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-45
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 4e-45
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 8e-36
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-33
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-32
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-31
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-30
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-29
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 3e-27
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 5e-27
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-26
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-26
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 1e-25
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 1e-25
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 2e-24
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 4e-24
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 6e-24
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 7e-24
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 7e-24
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 1e-23
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 2e-23
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 3e-23
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-22
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 4e-22
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 6e-22
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 7e-22
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 1e-21
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-21
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 2e-21
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 5e-21
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 6e-21
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 6e-21
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 1e-20
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 1e-20
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 2e-20
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 3e-20
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 4e-20
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 5e-20
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 7e-20
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 8e-20
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 9e-20
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 1e-19
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 1e-19
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 3e-19
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 4e-19
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 4e-19
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 4e-19
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 7e-19
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 1e-18
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 1e-18
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 3e-18
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 3e-18
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 5e-18
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 7e-18
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 8e-18
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 4e-17
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 7e-16
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 9e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
 Score =  388 bits (998), Expect = e-133
 Identities = 102/394 (25%), Positives = 170/394 (43%), Gaps = 14/394 (3%)

Query: 2   FVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSL 61
           F+      + +FT +   F   +  S    +G N+L     E H+  R++L   F   +L
Sbjct: 58  FISGALANRFLFTKEQETFQATWPLSTRILLGPNALATQMGEIHRSRRKILYQAFLPRTL 117

Query: 62  SKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCT 121
             ++   D ++   L +  +            ++TFD    + M     S   Q+     
Sbjct: 118 DSYLPKMDGIVQGYLEQWGK-ANEVIWYPQLRRMTFDVAATLFMGE-KVSQNPQLFPWFE 175

Query: 122 AVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRRSGEESFEDFLQSMLEKDSCP 181
                + S P  +P T + +  +AR  L+     +I  R+    S ED L  +L      
Sbjct: 176 TYIQGLFSLPIPLPNTLFGKSQRARALLLAELEKIIKARQQQPPSEEDALGILLA-ARDD 234

Query: 182 TNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKADG 241
            N+ LS  E+ D +L L+ AG  T  +A+      L  + + ++++R+EQ  +   +   
Sbjct: 235 NNQPLSLPELKDQILLLLFAGHETLTSALSSFCLLLGQHSDIRERVRQEQNKLQLSQE-- 292

Query: 242 AALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIH 301
             LT E +  M Y  +V++E LR+   +    R  + DC   GF   KGW V+   +  H
Sbjct: 293 --LTAETLKKMPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSYQISQTH 350

Query: 302 YDPALYKDPEQFNPSRF-----EEMQKSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTS 356
            DP LY DPE+F+P RF           ++ +PFG G R CLG   A++ M +F  RL  
Sbjct: 351 ADPDLYPDPEKFDPERFTPDGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLFATRLIQ 410

Query: 357 GYLWT-VDDPDLSLEKKSHIPRLRSGCPITLKPL 389
            + WT +   +L L   +  PR +    + L  L
Sbjct: 411 QFDWTLLPGQNLEL-VVTPSPRPKDNLRVKLHSL 443
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query402
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
Probab=100.00  E-value=3.6e-70  Score=512.55  Aligned_cols=382  Identities=26%  Similarity=0.433  Sum_probs=320.0

Q ss_pred             CccCChHHHhHhhhccccccccchhhhHHhhhCCCCccccCChhHHHHHHhhcCCCChHHHHHHHHHHHHHHHHHHHHHh
Q 015696            1 MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQ   80 (402)
Q Consensus         1 Vvv~~~~~i~~vl~~~~~~f~~~~~~~~~~~~g~~~l~~~~g~~~~~~R~~l~~~fs~~~l~~~~~~~~~~~~~~l~~l~   80 (402)
                      |+|++|+.+++|+.+++..|+.++......++|..++++.+|+.|+++|+++.+.|+.+.++.+.+.+.+.+.++++++.
T Consensus        57 vvv~~~~~~~~il~~~~~~~~~~~~~~~~~~~g~~~l~~~~g~~~~~~R~~~~~~f~~~~l~~~~~~i~~~~~~l~~~l~  136 (444)
T 2ve3_A           57 IFISGALANRFLFTKEQETFQATWPLSTRILLGPNALATQMGEIHRSRRKILYQAFLPRTLDSYLPKMDGIVQGYLEQWG  136 (444)
T ss_dssp             EEECSHHHHHHHTSSCTTTEEEECCHHHHHHHCTTSGGGCCHHHHHHHHHHHHGGGCHHHHHTTHHHHHHHHHHHHHHHH
T ss_pred             EEEcCHHHHHHHHhCCCcccccchhHHHHHHhCccccccCCchHHHHHHHHHHhhcCHHHHHHHHHHHHHHHHHHHHHhc
Confidence            57899999999998876667765544445566755788889999999999999999999999999999999999999985


Q ss_pred             hcCCceeHHHHHHHHHHHHHHHHhcCCCCchhhHHHHHHHHHHhccccccccccCchhhhhhHHHHHHHHHHHHHHHHHH
Q 015696           81 ESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKR  160 (402)
Q Consensus        81 ~~~~~v~~~~~~~~~~~~~i~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~i~~~  160 (402)
                       .++++|+.+++..++++++++++||...... ..+.+.+..+...+..++..+|...+.+..++.+++.+++.+.++++
T Consensus       137 -~~~~vd~~~~~~~~~~~vi~~~~fG~~~~~~-~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~i~~r  214 (444)
T 2ve3_A          137 -KANEVIWYPQLRRMTFDVAATLFMGEKVSQN-PQLFPWFETYIQGLFSLPIPLPNTLFGKSQRARALLLAELEKIIKAR  214 (444)
T ss_dssp             -HSSEEEHHHHHHHHHHHHHHHHHTCHHHHSC-TTHHHHHHHHHHHHSSCCCCSTTSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             -CCCcEeHHHHHHHHHHHHHHHHHcCCCcccH-HHHHHHHHHHHHHHhcCCccCCCcHHHHHHHHHHHHHHHHHHHHHHH
Confidence             4568999999999999999999999211111 33333333333333333445565555666777888899999999988


Q ss_pred             hcCCCchHHHHHHhhccCCCCCCCCCCHHHHHHHHHHHHHhchhhHHHHHHHHHHHHhhCHHHHHHHHHHHHHHHhccCC
Q 015696          161 RSGEESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQLAMIKDKAD  240 (402)
Q Consensus       161 ~~~~~~~~~~l~~ll~~~~~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~pe~q~~l~~Ei~~~~~~~~~  240 (402)
                      ++......|+++.|++..+. ++..++++++.++++.+++||+|||+.+++|++++|++||++|+|+++|++.+.+.   
T Consensus       215 ~~~~~~~~d~l~~ll~~~~~-~~~~l~~~~i~~~~~~~~~AG~~Tt~~~l~~~l~~L~~~P~~~~~l~~Ei~~~~~~---  290 (444)
T 2ve3_A          215 QQQPPSEEDALGILLAARDD-NNQPLSLPELKDQILLLLFAGHETLTSALSSFCLLLGQHSDIRERVRQEQNKLQLS---  290 (444)
T ss_dssp             HTSCCCCSSHHHHHHHCBCT-TSCBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHSSCCS---
T ss_pred             hcCCCCccCHHHHHHhcccc-CCCCCCHHHHHHHHHHHHHHcchHHHHHHHHHHHHHHHCHHHHHHHHHHHHHhccC---
Confidence            87655567999999986543 34469999999999999999999999999999999999999999999999998742   


Q ss_pred             CCCCCHHhhcCCchHHHHHHHhhcCcccccCccceecccceecCEEeCCCCEEeecchhhhcCCCCCCCCCCCCCCCCCC
Q 015696          241 GAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEE  320 (402)
Q Consensus       241 ~~~~~~~~~~~l~~l~a~i~E~lRl~p~~~~~~R~~~~d~~~~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~  320 (402)
                       ..++.+++.+||||+|||+|+||++|+++.++|.+.+|++++||.||||+.|.++.+++||||++|+||++|+||||++
T Consensus       291 -~~~~~~~l~~lpyl~a~i~E~lRl~p~~~~~~R~~~~d~~l~G~~Ip~Gt~V~~~~~~~~rdp~~~~dP~~F~PeR~l~  369 (444)
T 2ve3_A          291 -QELTAETLKKMPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSYQISQTHADPDLYPDPEKFDPERFTP  369 (444)
T ss_dssp             -SCCCHHHHTTCHHHHHHHHHHHHHSCSSCEEEEEESSCEEETTEEECTTCEEEEEHHHHTTCTTTSSSTTSCCGGGSST
T ss_pred             -CCCChhhhhcChHHHHHHHHHHhcCCCccCccceeCCCeeECCEEECCCCEEEechHHhcCChhhcCCcCccCccccCC
Confidence             3689999999999999999999999999988899999999999999999999999999999999999999999999996


Q ss_pred             CC-----CCCcccccCCCCCCCcchHHHHHHHHHHHHHHHhcceeeecCCCCcccc-ccccccCCCCcceEEEeCC
Q 015696          321 MQ-----KSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEK-KSHIPRLRSGCPITLKPLN  390 (402)
Q Consensus       321 ~~-----~~~~~~~Fg~G~r~C~G~~la~~~~~~~l~~ll~~f~~~~~~~~~~~~~-~~~~~~~~~~~~v~~~~~~  390 (402)
                      .+     .+..++|||+|+|.|+|++||++|++++++.||++|+|++.++.. ... ...+..|..+++|++++|.
T Consensus       370 ~~~~~~~~~~~~~pFG~G~r~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~-~~~~~~~~~~~~~~l~v~~~~r~  444 (444)
T 2ve3_A          370 DGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLFATRLIQQFDWTLLPGQN-LELVVTPSPRPKDNLRVKLHSLM  444 (444)
T ss_dssp             TSTTTTSCTTSCCTTCCGGGCCSCHHHHHHHHHHHHHHHHHHEEEEECSSCC-CCEEESSSEEETTCCEEEEEEC-
T ss_pred             CCcccCCCCceeeCCCCCCccCccHHHHHHHHHHHHHHHHHhCEEEeCCCCC-cceeccccccCCCCceEEEEeCC
Confidence            43     234699999999999999999999999999999999999875432 222 2345788899999999873
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 402
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-45
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-44
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 6e-40
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-37
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 3e-37
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-31
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 3e-26
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-25
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 8e-25
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 9e-24
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-23
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-23
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 6e-22
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 9e-22
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 5e-20
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 3e-17
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 3e-16
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 5e-16
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-15
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 3e-15
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 1e-14
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  161 bits (407), Expect = 2e-45
 Identities = 93/420 (22%), Positives = 167/420 (39%), Gaps = 32/420 (7%)

Query: 2   FVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSL 61
            +   +  K +   +  +              K+++     E  KR+R LLS  F+   L
Sbjct: 56  AITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKL 115

Query: 62  SKFVKTFDKM---LSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEK 118
            + V    +    L   L +  E+GK  ++ D     + D + +    V  DSL    + 
Sbjct: 116 KEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDP 175

Query: 119 DCTAVSDAM------------LSFPFMIPGTRYYRGIKARRRLMETFRGMIAK------- 159
                   +              FPF+IP           R +    R  + +       
Sbjct: 176 FVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLE 235

Query: 160 -RRSGEESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLH 218
             +     F   +          +++ LSD E++   +  I AG  TT++ + + +  L 
Sbjct: 236 DTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELA 295

Query: 219 DNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALN 278
            + + QQKL+EE  A++ +KA     T+  +  +     VV ETLR+  + +   RV   
Sbjct: 296 THPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDM---VVNETLRLFPIAMRLERVCKK 352

Query: 279 DCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQK----SYSFIPFGSGP 334
           D  I+G  I KG  V I +  +H DP  + +PE+F P RF +  K     Y + PFGSGP
Sbjct: 353 DVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGP 412

Query: 335 RTCLGMNMAKVTMLIFLHRLTSGYLWT-VDDPDLSLE-KKSHIPRLRSGCPITLKPLNKS 392
           R C+GM  A + M + L R+   + +    +  + L+     + +      + ++  + +
Sbjct: 413 RNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGT 472
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query402
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=3.7e-67  Score=490.82  Aligned_cols=384  Identities=19%  Similarity=0.333  Sum_probs=306.7

Q ss_pred             CccCChHHHhHhhhccccccccchh-hhHHhhhCCCCccccCChhHHHHHHhhcCCCChHHHHHHHHHHHHHHHHHHHHH
Q 015696            1 MFVPSTEGAKMIFTSDFANFNKGYV-KSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKL   79 (402)
Q Consensus         1 Vvv~~~~~i~~vl~~~~~~f~~~~~-~~~~~~~g~~~l~~~~g~~~~~~R~~l~~~fs~~~l~~~~~~~~~~~~~~l~~l   79 (402)
                      |+|+||+++++|+.++...|..+.. ..+..++| +|+++ ++..|+.+|+++.+.|+.+.++.+.+.+.+.+.++++.+
T Consensus        47 v~v~~p~~v~~i~~~~~~~~~~~~~~~~~~~~~g-~g~~~-~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~l  124 (445)
T d2ciba1          47 VLLSGSHANEFFFRAGDDDLDQAKAYPFMTPIFG-EGVVF-DASPERRKEMLHNAALRGEQMKGHAATIEDQVRRMIADW  124 (445)
T ss_dssp             EEECSHHHHHHHHHCCTTTEECTTSCGGGHHHHC----------------------CCHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             EEEcCHHHHHHHHhCCcccccCCccchhhHhhcC-Cceee-cCchHHHHHHHhccccCccccccchHHHHHHHHHhhhhc
Confidence            5789999999999888777776533 34455666 45543 577899999999999999999999999999999999988


Q ss_pred             hhcCCceeHHHHHHHHHHHHHHHHhcCCCCch-hhHHHHHHHHHHhcc---ccccccccCchhhhhhHHHHHHHHHHHHH
Q 015696           80 QESGKSFSILDFSMKLTFDAMCNMLMSVTDDS-LLGQIEKDCTAVSDA---MLSFPFMIPGTRYYRGIKARRRLMETFRG  155 (402)
Q Consensus        80 ~~~~~~v~~~~~~~~~~~~~i~~~~fG~~~~~-~~~~~~~~~~~~~~~---~~~~~~~~p~~~~~~~~~~~~~~~~~~~~  155 (402)
                      . .++++|+.+++..+++++++.++||.+..+ ....+.+.+..+...   +...+.++|....++..++++++.+++.+
T Consensus       125 ~-~~~~vdl~~~~~~~~~~~~~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~  203 (445)
T d2ciba1         125 G-EAGEIDLLDFFAELTIYTSSACLIGKKFRDQLDGRFAKLYHELERGTDPLAYVDPYLPIESFRRRDEARNGLVALVAD  203 (445)
T ss_dssp             C-SEEEEEHHHHHHHHHHHHHHHHHTCHHHHTTCCHHHHHHHHHHHTTCCGGGGTCTTCSCHHHHHHHHHHHHHHHHHHH
T ss_pred             c-cCCCcchHHhhhhhcceeeeeccccccccchhhhHHHHHHHHhhhhhhhhccccchhhhHHHHHHHHHHHHHHHHHHH
Confidence            4 456899999999999999999999987432 233344444444333   33344456666677788889999999999


Q ss_pred             HHHHHhcCC---CchHHHHHHhhccCCCCCCCCCCHHHHHHHHHHHHHhchhhHHHHHHHHHHHHhhCHHHHHHHHHHHH
Q 015696          156 MIAKRRSGE---ESFEDFLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLREEQL  232 (402)
Q Consensus       156 ~i~~~~~~~---~~~~~~l~~ll~~~~~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~pe~q~~l~~Ei~  232 (402)
                      .++++++..   ....|+++.|++...+..+..+++++++++++.+++||++||+.+++|++++|+.||++|+++++|++
T Consensus       204 ~i~~~~~~~~~~~~~~dll~~ll~~~~~~~~~~ls~~ei~~~~~~ll~ag~~tt~~~l~~~l~~L~~~p~~~~~lr~Ei~  283 (445)
T d2ciba1         204 IMNGRIANPPTDKSDRDMLDVLIAVKAETGTPRFSADEITGMFISMMFAGHHTSSGTASWTLIELMRHRDAYAAVIDELD  283 (445)
T ss_dssp             HHHHHHHCC-----CCCHHHHHHHCBCTTSSBSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHH
T ss_pred             HHhhhcccccccccccchhhhhhccccccccccCCcchhhhhhhhhhhhccccchhhccccccccccccccccccccccc
Confidence            998877653   34468999999876654455799999999999999999999999999999999999999999999999


Q ss_pred             HHHhccCCCCCCCHHhhcCCchHHHHHHHhhcCcccccCccceecccceecCEEeCCCCEEeecchhhhcCCCCCCCCCC
Q 015696          233 AMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQ  312 (402)
Q Consensus       233 ~~~~~~~~~~~~~~~~~~~l~~l~a~i~E~lRl~p~~~~~~R~~~~d~~~~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~  312 (402)
                      ++.+.   ++.++.+++.+||||+|||+|++|++|+++...|++++|+.++||.||||+.|+++.+.+||||++|+||++
T Consensus       284 ~~~~~---~~~~~~~~l~~lp~L~a~i~E~lRl~p~~~~~~~~~~~~~~~~~~~ip~g~~v~~~~~~~~~d~~~~~dp~~  360 (445)
T d2ciba1         284 ELYGD---GRSVSFHALRQIPQLENVLKETLRLHPPLIILMRVAKGEFEVQGHRIHEGDLVAASPAISNRIPEDFPDPHD  360 (445)
T ss_dssp             HHGGG---CCCHHHHTTSCCHHHHHHHHHHHHHSCSCCCEEEEECSCEEETTEEECTTCEEEECHHHHTTCTTTSSSTTS
T ss_pred             ccccc---cccchhhhcccchhhccccccccccccccceeccccccccccceeeccccccccccccccccCcccCCChhh
Confidence            99853   367899999999999999999999999999988999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCC-----CCCcccccCCCCCCCcchHHHHHHHHHHHHHHHhcceeeecCCCCcc--ccccccccCCCCcceE
Q 015696          313 FNPSRFEEMQ-----KSYSFIPFGSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSL--EKKSHIPRLRSGCPIT  385 (402)
Q Consensus       313 F~P~R~l~~~-----~~~~~~~Fg~G~r~C~G~~la~~~~~~~l~~ll~~f~~~~~~~~~~~--~~~~~~~~~~~~~~v~  385 (402)
                      |+||||++..     .+..|+|||+|+|.|||++||..|++++++.||++|+|++.++.+..  .....+..|..++.|+
T Consensus       361 F~PeRf~~~~~~~~~~~~~~~pFG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~  440 (445)
T d2ciba1         361 FVPARYEQPRQEDLLNRWTWIPFGAGRHRCVGAAFAIMQIKAIFSVLLREYEFEMAQPPESYRNDHSKMVVQLAQPAAVR  440 (445)
T ss_dssp             CCGGGGSTTTCHHHHCTTTCCTTCCGGGCCTTHHHHHHHHHHHHHHHHHHEEEEESSCGGGCCEECSSSSCEECSCCEEE
T ss_pred             CCcccccCccccccCCCCcccCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEECCCCCccccccceEEEccCCCEEEE
Confidence            9999999754     46789999999999999999999999999999999999997654332  2334557788899999


Q ss_pred             EEeCC
Q 015696          386 LKPLN  390 (402)
Q Consensus       386 ~~~~~  390 (402)
                      +++|+
T Consensus       441 ~~~Rs  445 (445)
T d2ciba1         441 YRRRT  445 (445)
T ss_dssp             EEEC-
T ss_pred             EEeCc
Confidence            99985
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure