Citrus Sinensis ID: 015713


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--
MDSCCAAALKANAHPAVSNRNTGFWGGSVKGSLKSWDLNFGSRVWKNLRTEKINKNVTKPGVAYSILTSDTNKETVTFQAPMFETPQADPKNVAAIILGGGAGTRLFPLTNRRAKPAVPIGGNYRLIDIPMSNCINSGFNKIFIMTQFNSFSLNRHLARSYNLGNGVNFGDGFVEVLAATQTPGEAGKKWFQGTADAVRQFIWVFEDAKNKNVENVLILSGDHLYRMDYTEFLQKHIDTKADITVSCVPMDDCRASDYGLMKIDRSGQIIQFAEKPKGPDLKGMQCDTTLLGLSMPDAVKFPYIASMGVYLFRTDVLLNLLRSSYPLSNDFGSEIIPASVKDHNVQAFLFNDYWEDIGTIKSFFMPIWPSQNSLRSLNFMIPRHLSIRLLDSCHPLKLIDAR
ccHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHcccccccccccEEEEEcccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccEEEEEEECccccccccccEEEEEEcccHHHHHHHHHHHcccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEccccccccccEEEEcccccEEEEEccccccccccccccccccccccccccccccEEEcccEEEcHHHHHHHHHHcccccccccccHHHHccccccEEEEccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccc
**************P*****NTGFW*GSVKGSLKS**********************TKPGVAYSILTSDTNKETVTFQAPMFE*****PKNVAAIILGGGAGTRLFPLTNRRAKPAVPIGGNYRLIDIPMSNCINSGFNKIFIMTQFNSFSLNRHLARSYNLGNGVNFGDGFVEVLAATQTPGEAGKKWFQGTADAVRQFIWVFEDAKNKNVENVLILSGDHLYRMDYTEFLQKHIDTKADITVSCVPMDDCRASDYGLMKIDRSGQIIQFAEKPKGPDLKGMQCDTTLLGLSMPDAVKFPYIASMGVYLFRTDVLLNLLRSSYPLSNDFGSEIIPASVKDHNVQAFLFNDYWEDIGTIKSFFMPIWPSQNSLRSLNFMIPRHLSIRLLDSCHPLKLI***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSCCAAALKANAHPAVSNRNTGFWGGSVKGSLKSWDLNFGSRVWKNLRTEKINKNVTKPGVAYSILTSDTNKETVTFQAPMFETPQADPKNVAAIILGGGAGTRLFPLTNRRAKPAVPIGGNYRLIDIPMSNCINSGFNKIFIMTQFNSFSLNRHLARSYNLGNGVNFGDGFVEVLAATQTPGEAGKKWFQGTADAVRQFIWVFEDAKNKNVENVLILSGDHLYRMDYTEFLQKHIDTKADITVSCVPMDDCRASDYGLMKIDRSGQIIQFAEKPKGPDLKGMQCDTTLLGLSMPDAVKFPYIASMGVYLFRTDVLLNLLRSSYPLSNDFGSEIIPASVKDHNVQAFLFNDYWEDIGTIKSFFMPIWPSQNSLRSLNFMIPRHLSIRLLDSCHPLKLIDAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucose-1-phosphate adenylyltransferase Catalyzes the synthesis of ADP-glucose, a sugar donor used in elongation reactions on alpha-glucans.probableB2IUY3
Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic This protein plays a role in synthesis of starch. It catalyzes the synthesis of the activated glycosyl donor, ADP-glucose from Glc-1-P and ATP.probableP55233
Glucose-1-phosphate adenylyltransferase Catalyzes the synthesis of ADP-glucose, a sugar donor used in elongation reactions on alpha-glucans.probableB8HM61

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.27Glucose-1-phosphate adenylyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YP2, chain A
Confidence level:very confident
Coverage over the Query: 89-397
View the alignment between query and template
View the model in PyMOL