Citrus Sinensis ID: 015714

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--
MQSENNTSAPTTPRLRHRRRSNEAIPDATKANGSHLLVHDRNKYKSFLVRAYSTVWMIAGFVLIVYMGHLYITAMVVVIQIFMARELFNLLRKAHEERDLPGFRMLNWHFFFTAMLFVYGRILSQRLVNTVTSDKFLYQFVSSLIKYHMVICYFLYISGFVWFILTLKKKMYKYQFSQYAWTHMILIVVFAQSSFTVASIFEGIFWFLLPASLIVINDIAAYIFGFFFGRTPLIKLSPKKTWEGFIGASVATITSAFVDLATGWLHCDPGPLFKPESFPLPGWLPWKEITILPVQWHALCLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYHQSFIVPQSFRVEMILEQILTALTYEEQKALYMKLGEILQERLFGQS
ccccccccccccccHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccc
**********************************HLLVHDRNKYKSFLVRAYSTVWMIAGFVLIVYMGHLYITAMVVVIQIFMARELFNLLRKAHEERDLPGFRMLNWHFFFTAMLFVYGRILSQRLVNTVTSDKFLYQFVSSLIKYHMVICYFLYISGFVWFILTLKKKMYKYQFSQYAWTHMILIVVFAQSSFTVASIFEGIFWFLLPASLIVINDIAAYIFGFFFGRTPLIKLSPKKTWEGFIGASVATITSAFVDLATGWLHCDPGPLFKPESFPLPGWLPWKEITILPVQWHALCLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYHQSFIVPQSFRVEMILEQILTALTYEEQKALYMKLGEILQERLF***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSENNTSAPTTPRLRHRRRSNEAIPDATKANGSHLLVHDRNKYKSFLVRAYSTVWMIAGFVLIVYMGHLYITAMVVVIQIFMARELFNLLRKAHEERDLPGFRMLNWHFFFTAMLFVYGRILSQRLVNTVTSDKFLYQFVSSLIKYHMVICYFLYISGFVWFILTLKKKMYKYQFSQYAWTHMILIVVFAQSSFTVASIFEGIFWFLLPASLIVINDIAAYIFGFFFGRTPLIKLSPKKTWEGFIGASVATITSAFVDLATGWLHCDPGPLFKPESFPLPGWLPWKEITILPVQWHALCLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYHQSFIVPQSFRVEMILEQILTALTYEEQKALYMKLGEILQERLFGQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidate cytidylyltransferase May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.probableO04940
Phosphatidate cytidylyltransferase 1 Provides CDP-diacylglycerol an important precursor for the synthesis of phosphatidylinositol (PtdIns), phosphatidylglycerol, and cardiolipin. Overexpression may amplify cellular signaling responses from cytokines. May also play an important role in the signal transduction mechanism of retina and neural cells.probableQ92903
Phosphatidate cytidylyltransferase 1 Provides CDP-diacylglycerol an important precursor for the synthesis of phosphatidylinositol (PtdIns), phosphatidylglycerol, and cardiolipin. Overexpression may amplify cellular signaling responses from cytokines. May also play an important role in the signal transduction mechanism of retina and neural cells.probableP98191

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.41Phosphatidate cytidylyltransferase.probable