BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015715
         (402 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|B4N549|QTRD1_DROWI Queuine tRNA-ribosyltransferase subunit QTRTD1 homolog
           OS=Drosophila willistoni GN=GK20504 PE=3 SV=1
          Length = 428

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 3/73 (4%)

Query: 197 GVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRA---RTKKFHRRVYDLRGSV 253
           G E+  P RY+EI+ S   +I Q   D ++     K  ++    RT++F   +Y+  G +
Sbjct: 128 GKESLTPERYMEIIASFKPDIYQGLCDADTNLESSKKRVQKSVDRTERFMDYIYEQHGKL 187

Query: 254 KCTNISEGPPCTG 266
           + T+ S   P  G
Sbjct: 188 QSTSSSLLAPIVG 200


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.322    0.136    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 154,579,410
Number of Sequences: 539616
Number of extensions: 6612955
Number of successful extensions: 12887
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 12886
Number of HSP's gapped (non-prelim): 8
length of query: 402
length of database: 191,569,459
effective HSP length: 120
effective length of query: 282
effective length of database: 126,815,539
effective search space: 35761981998
effective search space used: 35761981998
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)