BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015724
         (402 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XR4|A Chain A, X-ray Crystal Structure Of Putative Citrate Lyase Alpha
           Chain/citrate- Acp Transferase [salmonella Typhimurium]
 pdb|1XR4|B Chain B, X-ray Crystal Structure Of Putative Citrate Lyase Alpha
           Chain/citrate- Acp Transferase [salmonella Typhimurium]
          Length = 509

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%)

Query: 220 FVIYIITTYSLYVPNWSFSEHSDHGVKKYIVKCGMRGHLGPACNA 264
           F    + + SL   +W   EH  +GV + I   G+RG LG   +A
Sbjct: 89  FRDLTLASSSLIDAHWPLIEHIKNGVVRQIYTSGLRGKLGEEISA 133


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.141    0.447 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,986,213
Number of Sequences: 62578
Number of extensions: 493605
Number of successful extensions: 1073
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1072
Number of HSP's gapped (non-prelim): 1
length of query: 402
length of database: 14,973,337
effective HSP length: 101
effective length of query: 301
effective length of database: 8,652,959
effective search space: 2604540659
effective search space used: 2604540659
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)