Citrus Sinensis ID: 015742

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-
MASASGLFTPSVPSLRRRVQPSTWKYRSGFCFSQGTFRRVLCSSTIAGSEKSVSSSESRAPRLINRGCKLVGCGSAVPTLQISNDDLAKIVDTSDEWISVRTGIRNRRVLSGKESLTGLAVEAASRALQMAEVNPEDVDLVLMCTSTPEDLFGGATQIPKALGCKNNPLAYDITAACSGFLLGLVSAACHIRGGGFRNVLVIGGDALSRFTDWTDRGSCILFGDAAGAVLVQACDSEDDGLISFDVHSDGEGGRHLNACIKGNQTNDALGSNGSVLAFPPQHYSYSSIYMNGKEVFRFAVRVVPQTIESALEKAGLTMSSIDWLLLHQANQRIIDAVANRLDVPMERVISNLANYGNTSAASIPLALDEAVRSGKVKPGHTIAAAGFGAGLTWGSAILRWG
ccccccccccccccccccccccccccccccECcccccEEEEEEEccccccccccccccccccccccccEEEEEEEEcccccccHHHHHHHccccccHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHccccccccEEEEccccHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccEEEEcccccEEEEEEEcccccCEEEEEECccccccccccccccccccccccccccccccccccccccccCEEccccHHHHHHcccHHHHHHHHHHcccccccccEEEcHHHHHHHHHHHHHHccccccccEEcccccccccccHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHEEcc
*****G**TPSVPS*******STWKYRSGFCFSQGTFRRVLCSST*****************LINRGCKLVGCGSAVPTLQISNDDLAKIVDTSDEWISVRTGIRNRRVLSGKESLTGLAVEAASRALQMAEVNPEDVDLVLMCTSTPEDLFGGATQIPKALGCKNNPLAYDITAACSGFLLGLVSAACHIRGGGFRNVLVIGGDALSRFTDWTDRGSCILFGDAAGAVLVQACDSEDDGLISFDVHSDGEGGRHLNACIKGNQTNDALGSNGSVLAFPPQHYSYSSIYMNGKEVFRFAVRVVPQTIESALEKAGLTMSSIDWLLLHQANQRIIDAVANRLDVPMERVISNLANYGNTSAASIPLALDEAVRSGKVKPGHTIAAAGFGAGLTWGSAILRWG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASASGLFTPSVPSLRRRVQPSTWKYRSGFCFSQGTFRRVLCSSTIAGSEKSVSSSESRAPRLINRGCKLVGCGSAVPTLQISNDDLAKIVDTSDEWISVRTGIRNRRVLSGKESLTGLAVEAASRALQMAEVNPEDVDLVLMCTSTPEDLFGGATQIPKALGCKNNPLAYDITAACSGFLLGLVSAACHIRGGGFRNVLVIGGDALSRFTDWTDRGSCILFGDAAGAVLVQACDSEDDGLISFDVHSDGEGGRHLNACIKGNQTNDALGSNGSVLAFPPQHYSYSSIYMNGKEVFRFAVRVVPQTIESALEKAGLTMSSIDWLLLHQANQRIIDAVANRLDVPMERVISNLANYGNTSAASIPLALDEAVRSGKVKPGHTIAAAGFGAGLTWGSAILRWG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. KAS III catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities.confidentP49243
3-oxoacyl-[acyl-carrier-protein] synthase 3 Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.probableQ3M9J4
3-oxoacyl-[acyl-carrier-protein] synthase 3 Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.probableQ7V4F6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.180Beta-ketoacyl-acyl-carrier-protein synthase III.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X3E, chain A
Confidence level:very confident
Coverage over the Query: 66-264,278-401
View the alignment between query and template
View the model in PyMOL
Template: 3GWA, chain A
Confidence level:very confident
Coverage over the Query: 66-400
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2uv8, chain A confident Alignment | Template Structure