Citrus Sinensis ID: 015747

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-

MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGTPRTMACSDFV

cccHHHHHHHHHHHHccEEEcccccccccccccEEEEEEEcccccEEEEEccccccccccccEEEEEEcccccccccEEEEEcccccccccccccccccccccccccccccEEccccccccEEEccEEEEEEEEEccccEEEEEEEccccccEEEEEEccccccccccccccEEEEcccccEEEEEEEccccccccccEEEEEcccccccEEEcccEEEEcccccccccccccccccccEEEEEEcccccccEEEEEcccccccccccccccEEEEEcccccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccccc

ccHHHHHHHHHHHHHHHHHHHcccccccccHEEEEEEEEEEccccEEEEccHHcccccccccEEEEEEcccccccccEEEEEccccccccccccccccccccccccccEEEEEEEcccccccccccEEEEEEEEEccccEEEEEEcccccccEEEEEcccEEccccccccEEEEEEcccccEEEEEEEcccccccccEEEEEccccccEEEccccEEEEEEccccccccccccccccccEEEEEEcccccccEEEEEEEccccccccccccEEEEEccccccccccEEEEEEEccccccccccccccccccccHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccEccccccc

MRELRSICLGILLVLGAFRltishedqplskIAIHKAVFalddnayikaspsilgmkgqnsdwltveynspnpsvgdwigvfspsnfssstcpaenprvyppllcsapikfqyanysspqykstgkgslkLQLINQRSDFSFVLftngllnpkVVAVSNkvtftnpnapvyprlaqgkvwNEMTVTWTsgygineaepfvewgpkggdrtyspagtltfgrgsmcgapartvgwrdpgyihtgflrelwpnamytYKLGHRLFNGTYiwsseyqfkaspypgqdslqQVIIFGdmgkdeadgsneynnfqrgslNTTRQLIQDLKNIDIVFHIGDIcyangyisqwDQFTAqiepiastvpymiasgnherdwpgtgsfygnmdsggecgtprtmacsdfv

MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVtftnpnapvyprlaqgkvWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGTPRTMACSDFV

****RSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNF****C*AENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDM****************GSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFY*********************

***LRSICLGILLVLGAFRLTI***DQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGTPRTMA***FV

MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSN********ENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGTPRTMACSDFV

*RELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGTPRTMACSDF*

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		401	2.2.26 [Sep-21-2011]
Q9LMX4		613	Probable inactive purple	yes	no	0.977	0.639	0.727	1e-176
Q5MAU8		611	Probable inactive purple	no	no	0.950	0.623	0.654	1e-149
Q8H1R2		615	Probable inactive purple	no	no	0.912	0.595	0.625	1e-138
Q687E1		368	Nucleotide pyrophosphatas	N/A	no	0.321	0.350	0.666	1e-48
Q9ZQ81		651	Probable inactive purple	no	no	0.790	0.486	0.317	5e-33
Q9LMG7		656	Probable inactive purple	no	no	0.802	0.490	0.308	2e-32
Q8BX37		438	Iron/zinc purple acid pho	no	no	0.396	0.363	0.294	3e-09
A5D6U8		443	Iron/zinc purple acid pho	yes	no	0.384	0.347	0.323	1e-08
Q6ZNF0		438	Iron/zinc purple acid pho	yes	no	0.284	0.260	0.302	9e-08
Q9LXI4		437	Purple acid phosphatase 2	no	no	0.456	0.418	0.272	2e-05

>sp\|Q9LMX4\|PPA1_ARATH Probable inactive purple acid phosphatase 1 OS=Arabidopsis thaliana GN=PAP1 PE=2 SV=1	Back alignment and function desciption

 Score =  618 bits (1594), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 286/393 (72%), Positives = 333/393 (84%), Gaps = 1/393 (0%)

Query: 1   MRE-LRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQ 59
           MRE L +I + ++ VLGA     SHEDQPLS IA+HK  F L++ AY+KASP++LG  GQ
Sbjct: 1   MRESLVAILVTVISVLGAIHQVKSHEDQPLSGIAVHKITFGLNEKAYVKASPTVLGSNGQ 60

Query: 60  NSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSP 119
           +S+ + V+Y+SP PS  DWIGVFSP++F++STCP +N  V PP LCSAP+KFQYAN+S+P
Sbjct: 61  HSELVLVQYSSPKPSDDDWIGVFSPADFNASTCPGDNKMVQPPRLCSAPVKFQYANFSNP 120

Query: 120 QYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKV 179
           +Y +TG GSLKLQLINQRSDFSF LF+ GLLNPK+VA+SNKV F NPNAPVYPRLA GK 
Sbjct: 121 RYTNTGTGSLKLQLINQRSDFSFALFSGGLLNPKLVAISNKVAFENPNAPVYPRLALGKE 180

Query: 180 WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGY 239
           W+EMTVTWTSGYG+N AEP VEWG KGG+R  SPAGTLTF R SMCGAPARTVGWRDPGY
Sbjct: 181 WDEMTVTWTSGYGLNLAEPVVEWGVKGGERKLSPAGTLTFARNSMCGAPARTVGWRDPGY 240

Query: 240 IHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDE 299
           IHT FL+ELWPN+ YTY++GHRL NG  IWS EYQFK+SP+PGQ+S+QQV+IFGDMGK E
Sbjct: 241 IHTAFLKELWPNSKYTYRVGHRLSNGALIWSKEYQFKSSPFPGQNSVQQVVIFGDMGKAE 300

Query: 300 ADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIAST 359
            DGS+EYN+FQR SLNTT+QLI+DLK  D VFHIGDICYANGY+SQWDQF AQIEPIAST
Sbjct: 301 VDGSSEYNDFQRASLNTTKQLIKDLKKTDAVFHIGDICYANGYLSQWDQFIAQIEPIAST 360

Query: 360 VPYMIASGNHERDWPGTGSFYGNMDSGGECGTP 392
           VPYMIASGNHER WP +GSFY  +DSGGECG P
Sbjct: 361 VPYMIASGNHERVWPNSGSFYEGLDSGGECGVP 393

Arabidopsis thaliana (taxid: 3702)

>sp\|Q5MAU8\|PPA27_ARATH Probable inactive purple acid phosphatase 27 OS=Arabidopsis thaliana GN=PAP27 PE=2 SV=1	Back alignment and function description

>sp\|Q8H1R2\|PPA24_ARATH Probable inactive purple acid phosphatase 24 OS=Arabidopsis thaliana GN=PAP24 PE=2 SV=1	Back alignment and function description

>sp\|Q687E1\|NPP_HORVU Nucleotide pyrophosphatase/phosphodiesterase (Fragments) OS=Hordeum vulgare GN=npp PE=1 SV=2	Back alignment and function description

>sp\|Q9ZQ81\|PPA9_ARATH Probable inactive purple acid phosphatase 9 OS=Arabidopsis thaliana GN=PAP9 PE=2 SV=1	Back alignment and function description

>sp\|Q9LMG7\|PPA2_ARATH Probable inactive purple acid phosphatase 2 OS=Arabidopsis thaliana GN=PAP2 PE=2 SV=1	Back alignment and function description

>sp\|Q8BX37\|PAPL_MOUSE Iron/zinc purple acid phosphatase-like protein OS=Mus musculus GN=Papl PE=2 SV=2	Back alignment and function description

>sp\|A5D6U8\|PAPL_DANRE Iron/zinc purple acid phosphatase-like protein OS=Danio rerio GN=papl PE=2 SV=1	Back alignment and function description

>sp\|Q6ZNF0\|PAPL_HUMAN Iron/zinc purple acid phosphatase-like protein OS=Homo sapiens GN=PAPL PE=2 SV=2	Back alignment and function description

>sp\|Q9LXI4\|PPA21_ARATH Purple acid phosphatase 21 OS=Arabidopsis thaliana GN=PAP21 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		401
297738089		672	unnamed protein product [Vitis vinifera]	0.975	0.581	0.785	0.0
359472541		612	PREDICTED: probable inactive purple acid	0.975	0.638	0.785	0.0
224112110		614	predicted protein [Populus trichocarpa]	0.975	0.636	0.788	0.0
356526862		616	PREDICTED: probable inactive purple acid	0.950	0.618	0.776	0.0
449452841		612	PREDICTED: probable inactive purple acid	0.975	0.638	0.767	0.0
18075960		612	putative metallophosphatase [Lupinus lut	0.975	0.638	0.754	0.0
18075958		615	diphosphonucleotide phosphatase 1 [Lupin	0.975	0.635	0.757	0.0
224098974		621	predicted protein [Populus trichocarpa]	0.975	0.629	0.748	0.0
356567597		611	PREDICTED: probable inactive purple acid	0.947	0.621	0.778	0.0
357487749		945	U-box domain-containing protein [Medicag	0.955	0.405	0.753	1e-180

>gi\|297738089\|emb\|CBI27290.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/391 (78%), Positives = 346/391 (88%)

Query: 1   MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQN 60
           MR   +  L IL  L      ISH DQPL+KIAIH A FAL D AY+KASP++LG+ GQN
Sbjct: 61  MRVFGASLLAILWALACIEGAISHGDQPLAKIAIHNAKFALHDQAYVKASPTVLGLGGQN 120

Query: 61  SDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQ 120
           ++++TVE++SP+PSV DWIGVFSP+NFS+STC  E+ RV PPLLCSAPIK+QYANY+SP 
Sbjct: 121 TEFVTVEFSSPSPSVDDWIGVFSPANFSASTCLPEDIRVTPPLLCSAPIKYQYANYTSPN 180

Query: 121 YKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVW 180
           YK+TGKGSLKLQLINQRSDFSF LF+ GL+NPK+VAVSN V F NPNAPVYPRLAQGKVW
Sbjct: 181 YKNTGKGSLKLQLINQRSDFSFALFSGGLVNPKLVAVSNSVAFANPNAPVYPRLAQGKVW 240

Query: 181 NEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYI 240
           NEMTVTWTSGYGIN+A PF+EWG KGGD+  SPAGTLTF R SMCGAPA TVGWRDPGYI
Sbjct: 241 NEMTVTWTSGYGINDAAPFIEWGLKGGDKVRSPAGTLTFDRRSMCGAPASTVGWRDPGYI 300

Query: 241 HTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEA 300
           HT FL+ELWPN +Y+YKLGHRLFNGTYIWS +YQF+ASPYPGQ+SLQ+V+IFGDMGKDEA
Sbjct: 301 HTSFLKELWPNLVYSYKLGHRLFNGTYIWSQQYQFRASPYPGQNSLQRVVIFGDMGKDEA 360

Query: 301 DGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTV 360
           DGSNEYN +QRGSLNTT+QLI+DLKNIDIVFHIGDICYANGY+SQWDQFTAQ+E I STV
Sbjct: 361 DGSNEYNQYQRGSLNTTKQLIEDLKNIDIVFHIGDICYANGYLSQWDQFTAQVESITSTV 420

Query: 361 PYMIASGNHERDWPGTGSFYGNMDSGGECGT 391
           PYMIASGNHERDWPGTGSFYGN+DSGGECG 
Sbjct: 421 PYMIASGNHERDWPGTGSFYGNLDSGGECGV 451

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359472541\|ref\|XP_002274118.2\| PREDICTED: probable inactive purple acid phosphatase 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224112110\|ref\|XP_002316086.1\| predicted protein [Populus trichocarpa] gi\|222865126\|gb\|EEF02257.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356526862\|ref\|XP_003532035.1\| PREDICTED: probable inactive purple acid phosphatase 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|449452841\|ref\|XP_004144167.1\| PREDICTED: probable inactive purple acid phosphatase 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|18075960\|emb\|CAD12837.1\| putative metallophosphatase [Lupinus luteus]	Back alignment and taxonomy information

>gi\|18075958\|emb\|CAD12836.1\| diphosphonucleotide phosphatase 1 [Lupinus luteus]	Back alignment and taxonomy information

>gi\|224098974\|ref\|XP_002311341.1\| predicted protein [Populus trichocarpa] gi\|222851161\|gb\|EEE88708.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356567597\|ref\|XP_003552004.1\| PREDICTED: probable inactive purple acid phosphatase 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|357487749\|ref\|XP_003614162.1\| U-box domain-containing protein [Medicago truncatula] gi\|355515497\|gb\|AES97120.1\| U-box domain-containing protein [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		401
TAIR\|locus:2023870		613	AT1G13750 [Arabidopsis thalian	0.985	0.644	0.725	9e-164
TAIR\|locus:2177547		611	PAP27 "purple acid phosphatase	0.955	0.626	0.654	4.9e-140
TAIR\|locus:2117353		615	PAP24 "purple acid phosphatase	0.962	0.627	0.606	2.7e-132
TAIR\|locus:2014839		656	PAP2 "AT1G13900" [Arabidopsis	0.810	0.495	0.318	2.8e-34
TAIR\|locus:2063777		651	PAP9 "purple acid phosphatase	0.800	0.493	0.330	5.7e-34
DICTYBASE\|DDB_G0281861		594	DDB_G0281861 [Dictyostelium di	0.531	0.358	0.322	1.8e-27
DICTYBASE\|DDB_G0282559		431	dduA "N-terminal purple acid p	0.478	0.445	0.311	1.4e-12
FB\|FBgn0030245		458	CG1637 [Drosophila melanogaste	0.286	0.251	0.335	1.8e-09
MGI\|MGI:2142121		438	C330005M16Rik "RIKEN cDNA C330	0.281	0.257	0.343	1.7e-07
UNIPROTKB\|Q6ZNF0		438	PAPL "Iron/zinc purple acid ph	0.279	0.255	0.330	6e-07

TAIR\|locus:2023870 AT1G13750 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1594 (566.2 bits), Expect = 9.0e-164, P = 9.0e-164
 Identities = 288/397 (72%), Positives = 335/397 (84%)

Query:     1 MRE-LRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQ 59
             MRE L +I + ++ VLGA     SHEDQPLS IA+HK  F L++ AY+KASP++LG  GQ
Sbjct:     1 MRESLVAILVTVISVLGAIHQVKSHEDQPLSGIAVHKITFGLNEKAYVKASPTVLGSNGQ 60

Query:    60 NSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSP 119
             +S+ + V+Y+SP PS  DWIGVFSP++F++STCP +N  V PP LCSAP+KFQYAN+S+P
Sbjct:    61 HSELVLVQYSSPKPSDDDWIGVFSPADFNASTCPGDNKMVQPPRLCSAPVKFQYANFSNP 120

Query:   120 QYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKV 179
             +Y +TG GSLKLQLINQRSDFSF LF+ GLLNPK+VA+SNKV F NPNAPVYPRLA GK 
Sbjct:   121 RYTNTGTGSLKLQLINQRSDFSFALFSGGLLNPKLVAISNKVAFENPNAPVYPRLALGKE 180

Query:   180 WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGY 239
             W+EMTVTWTSGYG+N AEP VEWG KGG+R  SPAGTLTF R SMCGAPARTVGWRDPGY
Sbjct:   181 WDEMTVTWTSGYGLNLAEPVVEWGVKGGERKLSPAGTLTFARNSMCGAPARTVGWRDPGY 240

Query:   240 IHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDE 299
             IHT FL+ELWPN+ YTY++GHRL NG  IWS EYQFK+SP+PGQ+S+QQV+IFGDMGK E
Sbjct:   241 IHTAFLKELWPNSKYTYRVGHRLSNGALIWSKEYQFKSSPFPGQNSVQQVVIFGDMGKAE 300

Query:   300 ADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIAST 359
              DGS+EYN+FQR SLNTT+QLI+DLK  D VFHIGDICYANGY+SQWDQF AQIEPIAST
Sbjct:   301 VDGSSEYNDFQRASLNTTKQLIKDLKKTDAVFHIGDICYANGYLSQWDQFIAQIEPIAST 360

Query:   360 VPYMIASGNHERDWPGTGSFYGNMDSGGECGTP-RTM 395
             VPYMIASGNHER WP +GSFY  +DSGGECG P  TM
Sbjct:   361 VPYMIASGNHERVWPNSGSFYEGLDSGGECGVPAETM 397

GO:0003993 "acid phosphatase activity" evidence=IEA

GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS

GO:0005576 "extracellular region" evidence=ISM

GO:0016787 "hydrolase activity" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

GO:0006569 "tryptophan catabolic process" evidence=RCA

GO:0009627 "systemic acquired resistance" evidence=RCA

GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA

GO:0031347 "regulation of defense response" evidence=RCA

TAIR\|locus:2177547 PAP27 "purple acid phosphatase 27" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2117353 PAP24 "purple acid phosphatase 24" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2014839 PAP2 "AT1G13900" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2063777 PAP9 "purple acid phosphatase 9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0281861 DDB_G0281861 [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0282559 dduA "N-terminal purple acid phosphatase domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

FB\|FBgn0030245 CG1637 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

MGI\|MGI:2142121 C330005M16Rik "RIKEN cDNA C330005M16 gene" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6ZNF0 PAPL "Iron/zinc purple acid phosphatase-like protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LMX4	PPA1_ARATH	No assigned EC number	0.7277	0.9775	0.6394	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.3	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		401
cd00839		294	cd00839, MPP_PAPs, purple acid phosphatases of the	1e-23
PLN02533		427	PLN02533, PLN02533, probable purple acid phosphata	2e-07
pfam00149		185	pfam00149, Metallophos, Calcineurin-like phosphoes	3e-05
cd00838		131	cd00838, MPP_superfamily, metallophosphatase super	0.001

>gnl\|CDD\|163615 cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

 Score = 99.7 bits (249), Expect = 1e-23
 Identities = 37/101 (36%), Positives = 53/101 (52%), Gaps = 13/101 (12%)

Query: 287 QQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQ- 345
            +  +FGDMG++  +           S NT   L ++L N D + H+GD+ YA+GY +  
Sbjct: 5   FKFAVFGDMGQNTNN-----------STNTLDHLEKELGNYDAILHVGDLAYADGYNNGS 53

Query: 346 -WDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDS 385
            WD F  QIEP+AS VPYM+  GNHE D+  +         
Sbjct: 54  RWDTFMRQIEPLASYVPYMVTPGNHEADYNFSFYKIKAFFP 94

Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi. PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center. PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides. PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs). While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes. PAPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 294

>gnl\|CDD\|215292 PLN02533, PLN02533, probable purple acid phosphatase	Back alignment and domain information

>gnl\|CDD\|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase	Back alignment and domain information

>gnl\|CDD\|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		401
KOG1378		452	consensus Purple acid phosphatase [Carbohydrate tr	100.0
PLN02533		427	probable purple acid phosphatase	100.0
cd00839		294	MPP_PAPs purple acid phosphatases of the metalloph	99.48
PF09423		453	PhoD: PhoD-like phosphatase; InterPro: IPR018946 T	99.24
COG3540		522	PhoD Phosphodiesterase/alkaline phosphatase D [Ino	99.16
cd07378		277	MPP_ACP5 Homo sapiens acid phosphatase 5 and relat	98.83
cd07399		214	MPP_YvnB Bacillus subtilis YvnB and related protei	98.65
cd07395		262	MPP_CSTP1 Homo sapiens CSTP1 and related proteins,	98.56
PF00149		200	Metallophos: Calcineurin-like phosphoesterase; Int	98.49
cd07383		199	MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase	98.32
cd07396		267	MPP_Nbla03831 Homo sapiens Nbla03831 and related p	98.29
cd07402		240	MPP_GpdQ Enterobacter aerogenes GpdQ and related p	98.16
cd07385		223	MPP_YkuE_C Bacillus subtilis YkuE and related prot	98.0
PRK11148		275	cyclic 3',5'-adenosine monophosphate phosphodieste	97.97
PTZ00422		394	glideosome-associated protein 50; Provisional	97.94
cd00840		223	MPP_Mre11_N Mre11 nuclease, N-terminal metallophos	97.86
cd07400		144	MPP_YydB Bacillus subtilis YydB and related protei	97.8
cd00842		296	MPP_ASMase acid sphingomyelinase and related prote	97.79
KOG2679		336	consensus Purple (tartrate-resistant) acid phospha	97.74
PRK11340		271	phosphodiesterase YaeI; Provisional	97.73
PF12850		156	Metallophos_2: Calcineurin-like phosphoesterase su	97.71
KOG1432		379	consensus Predicted DNA repair exonuclease SIA1 [G	97.64
cd00838		131	MPP_superfamily metallophosphatase superfamily, me	97.61
cd07401		256	MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal	97.57
cd07388		224	MPP_Tt1561 Thermus thermophilus Tt1561 and related	97.34
cd00841		155	MPP_YfcE Escherichia coli YfcE and related protein	97.31
cd08165		156	MPP_MPPE1 human MPPE1 and related proteins, metall	97.15
cd07384		171	MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re	97.14
TIGR00619		253	sbcd exonuclease SbcD. This family is based on the	97.13
cd08163		257	MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related	97.08
cd07393		232	MPP_DR1119 Deinococcus radiodurans DR1119 and rela	96.97
PF00041		85	fn3: Fibronectin type III domain; InterPro: IPR003	96.89
COG1409		301	Icc Predicted phosphohydrolases [General function	96.87
PRK05340		241	UDP-2,3-diacylglucosamine hydrolase; Provisional	96.86
TIGR03729		239	acc_ester putative phosphoesterase. Members of thi	96.85
TIGR00040		158	yfcE phosphoesterase, MJ0936 family. Members of th	96.8
cd08166		195	MPP_Cdc1_like_1 uncharacterized subgroup related t	96.78
PRK10966		407	exonuclease subunit SbcD; Provisional	96.71
cd07392		188	MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel	96.7
cd07404		166	MPP_MS158 Microscilla MS158 and related proteins,	96.7
TIGR01854		231	lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase.	96.68
PRK09453		182	phosphodiesterase; Provisional	96.66
cd07397		238	MPP_DevT Myxococcus xanthus DevT and related prote	96.62
COG0420		390	SbcD DNA repair exonuclease [DNA replication, reco	96.55
cd07379		135	MPP_239FB Homo sapiens 239FB and related proteins,	96.54
PHA02546		340	47 endonuclease subunit; Provisional	96.45
cd07424		207	MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do	96.26
KOG4221		1381	consensus Receptor mediating netrin-dependent axon	96.25
cd07394		178	MPP_Vps29 Homo sapiens Vps29 and related proteins,	96.25
cd07390		168	MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro	96.15
KOG3662		410	consensus Cell division control protein/predicted	96.15
TIGR00583		405	mre11 DNA repair protein (mre11). All proteins in	96.06
PRK00166		275	apaH diadenosine tetraphosphatase; Reviewed	95.87
cd07423		234	MPP_PrpE Bacillus subtilis PrpE and related protei	95.83
cd07425		208	MPP_Shelphs Shewanella-like phosphatases, metallop	95.83
TIGR00024		225	SbcD_rel_arch putative phosphoesterase, SbcD/Mre11	95.75
cd07391		172	MPP_PF1019 Pyrococcus furiosus PF1019 and related	95.66
COG1408		284	Predicted phosphohydrolases [General function pred	95.59
cd07386		243	MPP_DNA_pol_II_small_archeal_C archeal DNA polymer	95.53
PRK09968		218	serine/threonine-specific protein phosphatase 2; P	95.52
cd00063		93	FN3 Fibronectin type 3 domain; One of three types	95.52
PHA02239		235	putative protein phosphatase	95.41
PRK13625		245	bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision	95.39
cd07398		217	MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat	95.05
cd08164		193	MPP_Ted1 Saccharomyces cerevisiae Ted1 and related	95.04
PRK04036		504	DNA polymerase II small subunit; Validated	94.99
cd07403		129	MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel	94.96
cd07413		222	MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat	94.96
PRK11439		218	pphA serine/threonine protein phosphatase 1; Provi	94.81
cd07421		304	MPP_Rhilphs Rhilph phosphatases, metallophosphatas	94.69
cd00845		252	MPP_UshA_N_like Escherichia coli UshA-like family,	94.63
KOG0196		996	consensus Tyrosine kinase, EPH (ephrin) receptor f	94.3
cd00144		225	MPP_PPP_family phosphoprotein phosphatases of the	94.29
PF14582		255	Metallophos_3: Metallophosphoesterase, calcineurin	94.27
cd07422		257	MPP_ApaH Escherichia coli ApaH and related protein	94.05
KOG3770		577	consensus Acid sphingomyelinase and PHM5 phosphate	93.96
cd07412		288	MPP_YhcR_N Bacillus subtilis YhcR endonuclease and	93.81
cd00844		262	MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t	93.53
cd07389		228	MPP_PhoD Bacillus subtilis PhoD and related protei	93.38
cd07408		257	MPP_SA0022_N Staphylococcus aureus SA0022 and rela	92.91
KOG3513		1051	consensus Neural cell adhesion molecule L1 [Signal	92.67
TIGR00668		279	apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric	92.27
smart00060		83	FN3 Fibronectin type 3 domain. One of three types	91.85
cd07406		257	MPP_CG11883_N Drosophila melanogaster CG11883 and	91.75
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	90.85
cd07382		255	MPP_DR1281 Deinococcus radiodurans DR1281 and rela	90.59
cd07411		264	MPP_SoxB_N Thermus thermophilus SoxB and related p	90.24
cd07420		321	MPP_RdgC Drosophila melanogaster RdgC and related	89.5
cd07410		277	MPP_CpdB_N Escherichia coli CpdB and related prote	89.37
PF10179		300	DUF2369: Uncharacterised conserved protein (DUF236	88.68
KOG4221		1381	consensus Receptor mediating netrin-dependent axon	88.04
COG0622		172	Predicted phosphoesterase [General function predic	88.03
PRK09419		1163	bifunctional 2',3'-cyclic nucleotide 2'-phosphodie	87.69
cd07405		285	MPP_UshA_N Escherichia coli UshA and related prote	86.73
cd07380		150	MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re	86.26
cd07418		377	MPP_PP7 PP7, metallophosphatase domain. PP7 is a p	85.99
COG0737		517	UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras	85.61
cd07416		305	MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca	85.22
COG2908		237	Uncharacterized protein conserved in bacteria [Fun	85.19
smart00156		271	PP2Ac Protein phosphatase 2A homologues, catalytic	84.58
PRK09558		551	ushA bifunctional UDP-sugar hydrolase/5'-nucleotid	84.17
cd07415		285	MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein	84.16
cd07407		282	MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and	83.2
TIGR03768		492	RPA4764 metallophosphoesterase, RPA4764 family. Th	82.65
cd07414		293	MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme	82.03
cd07419		311	MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a	81.99
TIGR00282		266	metallophosphoesterase, MG_246/BB_0505 family. A m	80.56
TIGR01530		550	nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi	80.05
COG2129		226	Predicted phosphoesterases, related to the Icc pro	80.02

>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=4.1e-41  Score=342.17  Aligned_cols=203  Identities=40%  Similarity=0.664  Sum_probs=166.6

Q ss_pred             CCCCcccEeeeCCCCCeEEEEEEeCCCCCCCccEEEEeecCCCCcee-cccceEEeccccCCCCCccccccCCceEEEEE
Q 015747          166 PNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYS-PAGTLTFGRGSMCGAPARTVGWRDPGYIHTGF  244 (401)
Q Consensus       166 ~~~P~qvhLa~~~d~~sm~VtW~T~~~~~~~~~~V~yG~~~~~~~~~-aa~t~ty~~~dmcg~pA~t~g~~dpg~iH~a~  244 (401)
                      .+.|+||||+++++.++|+|+|.|.+..   ...|+||...+..... +.+.    ...+|+....  +|+..|++|+|+
T Consensus        42 ~~~peQvhlS~~~~~~~m~VswvT~~~~---~~~V~Yg~~~~~~~~~~~~~~----~~~~~~~y~~--~~~~sg~ih~~~  112 (452)
T KOG1378|consen   42 VNSPEQVHLSFTDNLNEMRVSWVTGDGE---ENVVRYGEVKDKLDNSAARGM----TEAWTDGYAN--GWRDSGYIHDAV  112 (452)
T ss_pred             CCCCCeEEEeccCCCCcEEEEEeCCCCC---CceEEEeecCCCccccccccc----eEEEeccccc--ccceeeeEeeee
Confidence            4789999999999878999999999753   4899999765543222 1221    1122333332  678899999999


Q ss_pred             eCCCCCCCEEEEEEceecCCCCccccceEEEEeCCCCCCCCceEEEEEecCCCCCCCCCCccccccccchHHHHHHHHhc
Q 015747          245 LRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDL  324 (401)
Q Consensus       245 LtgL~PgT~Y~YrVG~~~~dg~~~wS~~~sF~T~P~~g~~~~~rfi~fGDmG~~~~dgs~~y~~~qp~s~~t~~~l~~~~  324 (401)
                      |++|+|+|+||||||++     ..||++|+|+|+|  +++.+.+|++|||||..+...             ++..+..+.
T Consensus       113 ~~~L~~~t~YyY~~Gs~-----~~wS~~f~F~t~p--~~~~~~~~~i~GDlG~~~~~~-------------s~~~~~~~~  172 (452)
T KOG1378|consen  113 MKNLEPNTRYYYQVGSD-----LKWSEIFSFKTPP--GQDSPTRAAIFGDMGCTEPYT-------------STLRNQEEN  172 (452)
T ss_pred             ecCCCCCceEEEEeCCC-----CCcccceEeECCC--CccCceeEEEEcccccccccc-------------chHhHHhcc
Confidence            99999999999999997     3599999999999  455789999999999986422             334444444


Q ss_pred             CCCcEEEeecceeccCCCc-chHHHHhhhhhhhhccccEEEcccCccccCCCCCCccccCCCCCcCcccccccc
Q 015747          325 KNIDIVFHIGDICYANGYI-SQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGTPRTMAC  397 (401)
Q Consensus       325 ~~~DfVlh~GDisYa~g~~-~~WD~f~~~iepias~vPym~a~GNHE~d~~~~~~~y~~~DsgGECGvp~~~~~  397 (401)
                      +++|+|+|+|||+||+++. .+||+|++++||+|+.+|||++.||||++|+.+++|+...+...+|+.+.+..+
T Consensus       173 ~k~d~vlhiGDlsYa~~~~n~~wD~f~r~vEp~As~vPymv~~GNHE~d~~~~~~F~~y~~Rf~mP~~~s~s~~  246 (452)
T KOG1378|consen  173 LKPDAVLHIGDLSYAMGYSNWQWDEFGRQVEPIASYVPYMVCSGNHEIDWPPQPCFVPYSARFNMPGNSSESDS  246 (452)
T ss_pred             cCCcEEEEecchhhcCCCCccchHHHHhhhhhhhccCceEEecccccccCCCcccccccceeeccCCCcCCCCC
Confidence            5799999999999999999 699999999999999999999999999999999999888999999999876544

>PLN02533 probable purple acid phosphatase	Back alignment and domain information

>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B	Back alignment and domain information

>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain	Back alignment and domain information

>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11	Back alignment and domain information

>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain	Back alignment and domain information

>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional	Back alignment and domain information

>PTZ00422 glideosome-associated protein 50; Provisional	Back alignment and domain information

>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain	Back alignment and domain information

>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain	Back alignment and domain information

>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11340 phosphodiesterase YaeI; Provisional	Back alignment and domain information

>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily []	Back alignment and domain information

>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only]	Back alignment and domain information

>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain	Back alignment and domain information

>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain	Back alignment and domain information

>TIGR00619 sbcd exonuclease SbcD	Back alignment and domain information

>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain	Back alignment and domain information

>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes []	Back alignment and domain information

>COG1409 Icc Predicted phosphohydrolases [General function prediction only]	Back alignment and domain information

>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional	Back alignment and domain information

>TIGR03729 acc_ester putative phosphoesterase	Back alignment and domain information

>TIGR00040 yfcE phosphoesterase, MJ0936 family	Back alignment and domain information

>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain	Back alignment and domain information

>PRK10966 exonuclease subunit SbcD; Provisional	Back alignment and domain information

>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain	Back alignment and domain information

>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase	Back alignment and domain information

>PRK09453 phosphodiesterase; Provisional	Back alignment and domain information

>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain	Back alignment and domain information

>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair]	Back alignment and domain information

>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain	Back alignment and domain information

>PHA02546 47 endonuclease subunit; Provisional	Back alignment and domain information

>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain	Back alignment and domain information

>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms]	Back alignment and domain information

>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain	Back alignment and domain information

>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair]	Back alignment and domain information

>TIGR00583 mre11 DNA repair protein (mre11)	Back alignment and domain information

>PRK00166 apaH diadenosine tetraphosphatase; Reviewed	Back alignment and domain information

>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain	Back alignment and domain information

>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related	Back alignment and domain information

>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain	Back alignment and domain information

>COG1408 Predicted phosphohydrolases [General function prediction only]	Back alignment and domain information

>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain	Back alignment and domain information

>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional	Back alignment and domain information

>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin	Back alignment and domain information

>PHA02239 putative protein phosphatase	Back alignment and domain information

>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional	Back alignment and domain information

>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain	Back alignment and domain information

>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK04036 DNA polymerase II small subunit; Validated	Back alignment and domain information

>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional	Back alignment and domain information

>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain	Back alignment and domain information

>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain	Back alignment and domain information

>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]	Back alignment and domain information

>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A	Back alignment and domain information

>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain	Back alignment and domain information

>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism]	Back alignment and domain information

>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	Back alignment and domain information

>smart00060 FN3 Fibronectin type 3 domain	Back alignment and domain information

>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi	Back alignment and domain information

>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms]	Back alignment and domain information

>COG0622 Predicted phosphoesterase [General function prediction only]	Back alignment and domain information

>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed	Back alignment and domain information

>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07418 MPP_PP7 PP7, metallophosphatase domain	Back alignment and domain information

>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism]	Back alignment and domain information

>cd07416 MPP_PP2B PP2B, metallophosphatase domain	Back alignment and domain information

>COG2908 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain	Back alignment and domain information

>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed	Back alignment and domain information

>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain	Back alignment and domain information

>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family	Back alignment and domain information

>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain	Back alignment and domain information

>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family	Back alignment and domain information

>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN	Back alignment and domain information

>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		401
1xzw_A		426	Purple acid phosphatase; hydrolase; HET: NAG FUC M	3e-43
2qfp_A		424	Purple acid phosphatase; binuclear, Fe-Zn, hydrola	8e-41
1ute_A		313	Protein (II purple acid phosphatase); tartrate res	5e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06

>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426	Back alignment and structure

 Score =  155 bits (393), Expect = 3e-43
 Identities = 44/223 (19%), Positives = 78/223 (34%), Gaps = 34/223 (15%)

Query: 165 NPNAPVYPRLAQGKVW-NEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGS 223
             NAP    + QG      + ++WT+ Y    A     W      +  +    +T+   +
Sbjct: 21  GYNAPQQVHITQGDYEGRGVIISWTTPYDKAGANKVFYWSENSKSQKRAMGTVVTYKYYN 80

Query: 224 MCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQ 283
                          +IH   +++L  +  Y Y+LG            ++ F   P PG 
Sbjct: 81  YTS-----------AFIHHCTIKDLEYDTKYYYRLGFGD------AKRQFWFVTPPKPGP 123

Query: 284 DSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYI 343
           D      + GD+G+               S  T     Q+      V  +GD+ Y+N + 
Sbjct: 124 DVPYVFGLIGDIGQTHD------------SNTTLTHYEQNSAKGQAVLFMGDLSYSNRWP 171

Query: 344 ----SQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGN 382
               ++WD +    E   +  P++  +GNHE D+      Y  
Sbjct: 172 NHDNNRWDTWGRFSERSVAYQPWIWTAGNHEIDYAPDIGEYQP 214

PyMOL of 1xzw

>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Length = 424	Back alignment and structure

>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Length = 313	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		401
1xzw_A		426	Purple acid phosphatase; hydrolase; HET: NAG FUC M	99.98
2qfp_A		424	Purple acid phosphatase; binuclear, Fe-Zn, hydrola	99.97
2yeq_A		527	Apased, PHOD, alkaline phosphatase D; hydrolase, p	99.76
1ute_A		313	Protein (II purple acid phosphatase); tartrate res	98.66
3tgh_A		342	Glideosome-associated protein 50; phosphatase fold	98.38
3ib7_A		330	ICC protein; metallophosphoesterase, alpha-beta fo	98.31
2nxf_A		322	Putative dimetal phosphatase; dinuclear metal cent	98.14
3d03_A		274	Phosphohydrolase; glycerophosphodiesterase, metall	98.11
1uf3_A		228	Hypothetical protein TT1561; metallo-dependent pho	98.08
2ede_A		114	Netrin receptor DCC; tumor suppressor protein DCC,	97.82
2ibg_A		214	CG9211-PA, GH03927P; IHOG, fibronectin type III, p	97.78
2xmo_A		443	LMO2642 protein; phosphodiesterase, hydrolase; 1.7	97.74
1x5l_A		111	Ephrin type-A receptor 8; FN3 domain, structural g	97.72
2dju_A		106	Receptor-type tyrosine-protein phosphatase F; LAR	97.7
2dm4_A		108	Sortilin-related receptor; beta-sandwich, sorting	97.62
3n06_B		210	PRL-R, prolactin receptor; PH dependence, hematopo	97.61
1x5f_A		120	Neogenin; RGM binding, fibronectin type III domain	97.61
1qr4_A		186	Protein (tenascin); fibronectin type-III, heparin,	97.59
2crz_A		110	Fibronectin type-III domain containing protein 3A;	97.59
1x4y_A		114	Biregional cell adhesion molecule-related/DOWN- re	97.59
2edy_A		103	Receptor-type tyrosine-protein phosphatase F; LAR	97.58
2q8u_A		336	Exonuclease, putative; structural genomics, joint	97.58
1x5z_A		115	Receptor-type tyrosine-protein phosphatase delta;	97.57
1x4x_A		106	Fibronectin type-III domain containing protein 3A;	97.57
2yvt_A		260	Hypothetical protein AQ_1956; structural genomics,	97.56
2djs_A		108	Ephrin type-B receptor 1; tyrosine-protein kinase	97.55
3p4l_A		211	Neogenin; iron homeostasis, hemojuvelin receptor,	97.54
2edd_A		123	Netrin receptor DCC; tumor suppressor protein DCC,	97.53
1x5x_A		109	Fibronectin type-III domain containing protein 3A;	97.53
1x5a_A		107	Ephrin type-A receptor 1; tyrosine-protein kinase	97.44
1x5g_A		116	Neogenin; RGM binding, fibronectin type III domain	97.43
3av0_A		386	DNA double-strand break repair protein MRE11; DNA	97.43
2ed7_A		119	Netrin receptor DCC; tumor suppressor protein DCC,	97.4
2e7h_A		109	Ephrin type-B receptor 4; FN3 domain, tyrosine- pr	97.39
2haz_A		105	N-CAM 1, neural cell adhesion molecule 1; fibronec	97.39
2ed8_A		106	Netrin receptor DCC; tumor suppressor protein DCC,	97.36
2ee2_A		119	Contactin-1; neural cell surface protein F3, glyco	97.36
1wfo_A		130	Sidekick 2; FN3, cell adhesion, structural genomic	97.35
1x5j_A		113	Neogenin; RGM binding, fibronectin type III domain	97.34
2db8_A		110	Tripartite motif protein 9, isoform 2; ring finger	97.33
1s3l_A		190	Hypothetical protein MJ0936; phosphodiesterase, nu	97.27
1ii7_A		333	MRE11 nuclease; RAD50, DNA double-strand break rep	97.27
2crm_A		120	Fibronectin type-III domain containing protein 3A;	97.26
1nnw_A		252	Hypothetical protein; structural genomics, PSI, pr	97.21
2a22_A		215	Vacuolar protein sorting 29; alpha-beta-BETA-alpha	97.2
1va9_A		122	DOWN syndrome cell adhesion molecule like- protein	97.19
3tho_B		379	Exonuclease, putative; adenosine triphosphate, bac	97.19
1su1_A		208	Hypothetical protein YFCE; structural genomics, ph	97.19
2jll_A		389	NCAM2, neural cell adhesion molecule 2; immunoglob	97.15
1x3d_A		118	Fibronectin type-III domain containing protein 3A;	97.14
1x4z_A		121	Biregional cell adhesion molecule-related/DOWN- re	97.13
1z2w_A		192	Vacuolar protein sorting 29; VPS29, retromer, phos	97.13
2ed9_A		124	Netrin receptor DCC; tumor suppressor protein DCC,	97.1
3ck2_A		176	Conserved uncharacterized protein (predicted phosp	97.07
1cd9_B		215	G-CSF-R, protein (G-CSF receptor); class1 cytokine	97.04
2vkw_A		209	Neural cell adhesion molecule 1,140 kDa isoform; a	97.03
2kbg_A		114	N-CAM 2, neural cell adhesion molecule 2; fibronec	97.02
3lpw_A		197	A77-A78 domain from titin; intracellular FNIII-tan	97.01
2dmk_A		127	Midline 2 isoform 2; midline defect 2, tripartite	97.0
1xm7_A		195	Hypothetical protein AQ_1665; structural genomics,	97.0
1k85_A		88	Chitinase A1; fibronectin type III domain, chitin	96.99
1x5h_A		132	Neogenin; RGM binding, fibronectin type III domain	96.98
3l5i_A		290	Interleukin-6 receptor subunit beta; cytokine rece	96.98
2yrz_A		118	Integrin beta-4; GP150, CD104 antigen, structural	96.98
3f7q_A		234	Integrin beta-4, GP150; hemidesmosome, cell adhesi	96.98
3p4l_A		211	Neogenin; iron homeostasis, hemojuvelin receptor,	96.94
2dn7_A		107	Receptor-type tyrosine-protein phosphatase F; LAR	96.94
2dle_A		104	Receptor-type tyrosine-protein phosphatase ETA; pr	96.93
2dlh_A		121	Receptor-type tyrosine-protein phosphatase delta;	96.92
1bqu_A		215	Protein (GP130); cytokine receptor, glycoprotein 1	96.91
3t1i_A		431	Double-strand break repair protein MRE11A; DNA rep	96.9
3rl5_A		296	Metallophosphoesterase mpped2; alpha-beta fold, me	96.87
1bpv_A		112	Titin, A71, connectin; fibronectin type III; NMR {	96.83
2edx_A		134	Protein tyrosine phosphatase, receptor type, F; LA	96.81
2e3v_A		122	Neural cell adhesion molecule 1, 140 kDa isoform;	96.81
2gee_A		203	Hypothetical protein; fibronectin, EIIIB, cancer,	96.8
2d9q_B		313	Granulocyte colony-stimulating factor receptor; cy	96.78
2yuw_A		110	Myosin binding protein C, SLOW type; fibronectin I	96.75
2dbj_A		124	Proto-oncogene tyrosine-protein kinase MER precurs	96.73
2rb8_A		104	Tenascin; beta sheet,loop design, alternative spli	96.73
1axi_B		236	HGHBP, growth hormone receptor; complex (hormone-r	96.72
2vkw_A		209	Neural cell adhesion molecule 1,140 kDa isoform; a	96.71
1uem_A		117	KIAA1568 protein; immunoglobulin-like beta-sandwic	96.71
3fl7_A		536	Ephrin receptor; ATP-binding, kinase, nucleotide-b	96.71
3v6o_A		206	Leptin receptor; receptor-antibody complex, cytoki	96.7
1tdq_A		283	Tenascin-R; extracellular matrix, lecticans, tenas	96.68
3r8q_A		290	Fibronectin; heparin, FNIII, heparin binding, cell	96.67
1wis_A		124	KIAA1514 protein; FNIII domain, sidekick-2, struct	96.66
1i1r_A		303	GP130, interleukin-6 receptor beta chain; cytokine	96.66
3rqz_A		246	Metallophosphoesterase; PSI-biology, midwest cente	96.66
1wf5_A		121	Sidekick 2 protein; FNIII domain, structural genom	96.6
2kkn_A		178	Uncharacterized protein; protein phosphatase 2A ho	96.59
1fnf_A		368	Fibronectin; RGD, extracellular matrix, cell adhes	96.57
3f7q_A		234	Integrin beta-4, GP150; hemidesmosome, cell adhesi	96.55
2ee3_A		108	Collagen alpha-1(XX) chain; KIAA1510, structural g	96.54
3b83_A		100	Ten-D3; beta sheet, computational redesigned prote	96.54
1uc6_A		109	CNTF receptor, ciliary neurotrophic factor recepto	96.53
1uen_A		125	KIAA0343 protein; immunoglobulin-like beta-sandwic	96.5
2cuh_A		115	Tenascin-X; fibronectin type III domain, extracell	96.47
3qfm_A		270	SAPH, putative uncharacterized protein; sandwich f	96.47
3mtr_A		215	N-CAM-1, NCAM-1, neural cell adhesion molecule 1;	96.44
1x5y_A		111	Myosin binding protein C, fast-type; fast MYBP-C,	96.44
1uey_A		127	KIAA0343 protein; immunoglobulin-like beta-sandwic	96.41
2dkm_A		104	Collagen alpha-1(XX) chain; FN3 domain, KIAA1510,	96.41
2gee_A		203	Hypothetical protein; fibronectin, EIIIB, cancer,	96.4
3teu_A		98	Fibcon; FN3 domain, fibronectin TPYE III domain, c	96.39
4fbk_A		472	DNA repair and telomere maintenance protein NBS1,	96.39
3lpw_A		197	A77-A78 domain from titin; intracellular FNIII-tan	96.37
1g5b_A		221	Serine/threonine protein phosphatase; bacteriophag	96.37
1cfb_A		205	Drosophila neuroglian; neural adhesion molecule; H	96.36
4fbw_A		417	DNA repair protein RAD32; DNA double-strand break	96.35
1wfn_A		119	Sidekick 2; FN3, cell adhesion, structural genomic	96.31
1n26_A		325	IL-6 receptor alpha chain; transmembrane, glycopro	96.3
3n1f_C		102	Cell adhesion molecule-related/DOWN-regulated BY;	96.29
3r8q_A		290	Fibronectin; heparin, FNIII, heparin binding, cell	96.26
1ujt_A		120	KIAA1568 protein; fibronectin type III domain, str	96.25
1v5j_A		108	KIAA1355 protein, RSGI RUH-008; FN3 domain, human	96.21
3up1_A		223	Interleukin-7 receptor subunit alpha; cytokine rec	96.19
2yux_A		120	Myosin-binding protein C, SLOW-type; fibronectin I	96.19
2cum_A		105	Tenascin-X; hexabrachion-like, fibronectin type II	96.17
1zlg_A		680	Anosmin 1; insulin-like growth factor receptor Cys	96.17
1fnf_A		368	Fibronectin; RGD, extracellular matrix, cell adhes	96.15
2ha1_A		201	Fibronectin; beta sandwich, protein-protein comple	96.06
2b5i_B		214	Interleukin-2 receptor beta chain; four-helix bund	96.04
1tdq_A		283	Tenascin-R; extracellular matrix, lecticans, tenas	96.02
1wk0_A		137	KIAA0970 protein; fibronectin type III domain, str	95.94
3mpc_A		103	FN3-like protein; fibronectin, FN(III), unknown fu	95.93
2qbw_A		195	PDZ-fibronectin fusion protein; fibronectin PDZ, u	95.88
1wfu_A		120	Unnamed protein product; FN3 domain, similar to 17	95.84
1eer_B		227	Epobp, erythropoietin receptor; signal transductio	95.82
2cui_A		112	Tenascin-X; fibronectin type III domain, extracell	95.79
2ic2_A		115	CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t	95.73
1j8k_A		94	Fibronectin; EDA, TYPEIII domain, protein binding;	95.68
1qr4_A		186	Protein (tenascin); fibronectin type-III, heparin,	95.68
2q7n_A		488	Leukemia inhibitory factor receptor; cytokine cell	95.59
2dfj_A		280	Diadenosinetetraphosphatase; helices and strands m	95.56
2qjc_A		262	Diadenosine tetraphosphatase, putative; putative d	95.45
2ocf_D		121	Fibronectin; estrogen receptor, LBD, monobody, est	95.43
1x5i_A		126	Neogenin; RGM binding, fibronectin type III domain	95.31
2ibg_A		214	CG9211-PA, GH03927P; IHOG, fibronectin type III, p	95.27
3t1w_A		375	Four-domain fibronectin fragment; human fibronecti	95.17
2z72_A		342	Protein-tyrosine-phosphatase; cold-active enzyme,	95.06
3k2m_C		101	Monobody HA4; engineered binding protein, antibody	95.05
3t1w_A		375	Four-domain fibronectin fragment; human fibronecti	95.0
3tes_A		98	Tencon; fibronectin type III domain, FN3, consensu	94.96
3t04_D		103	Monobody 7C12; engineered binding protein, antibod	94.92
2ekj_A		105	Collagen alpha-1(XX) chain; KIAA1510, structural g	94.89
3e0g_A		483	Leukemia inhibitory factor receptor; IG domain, cy	94.84
3qwq_B		114	Adnectin; cell surface receptor, tyrosine kinase,	94.82
3l5h_A		589	Interleukin-6 receptor subunit beta; IG-like, FNII	94.72
3tgx_A		219	Interleukin-21 receptor; class I cytokine, class I	94.68
3qht_C		97	Monobody YSMB-1; fibronectin type III, yeast small	94.58
2edb_A		116	Netrin receptor DCC; tumor suppressor protein DCC,	94.54
1cfb_A		205	Drosophila neuroglian; neural adhesion molecule; H	94.5
1wj3_A		117	KIAA1496 protein; beta sandwich, PANG, structural	94.5
1oww_A		98	FN, fibronectin first type III module, CIG; fibron	94.44
2v5y_A		731	Receptor-type tyrosine-protein phosphatase MU; mem	94.31
3l5i_A		290	Interleukin-6 receptor subunit beta; cytokine rece	94.23
2b5i_C		199	Cytokine receptor common gamma chain; four-helix b	94.13
2w1n_A		238	O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol	93.57
4go6_B		232	HCF C-terminal chain 1; tandem fibronectin repeat,	93.52
2gys_A		419	Cytokine receptor common beta chain; dimer of inte	93.36
2jll_A		389	NCAM2, neural cell adhesion molecule 2; immunoglob	93.29
3bpo_C		314	Interleukin-13 receptor alpha-1 chain; IL4, IL13,	93.18
3csg_A		461	MBP, maltose-binding protein monobody YS1 fusion,	93.14
1iar_B		207	Protein (interleukin-4 receptor alpha chain); cyto	92.61
2z1a_A		552	5'-nucleotidase; metal-binding, nucleotide-binding	92.55
2ie4_C		309	PP2A-alpha;, serine/threonine-protein phosphatase	92.45
2h41_A		95	Fibronectin; beta sandwich, cell adhesion, structu	92.25
3ztv_A		579	NAD nucleotidase, NADN; hydrolase, NAD pyrophospha	92.09
1hp1_A		516	5'-nucleotidase; metallophosphatase, dinuclear, me	91.81
3icf_A		335	PPT, serine/threonine-protein phosphatase T; IRO m	91.69
3se4_A		414	Interferon alpha/beta receptor 1; type I interfero	91.66
2erj_C		247	Cytokine receptor common gamma chain; immune syste	91.6
1zlg_A		680	Anosmin 1; insulin-like growth factor receptor Cys	91.43
3s98_A		306	Interferon alpha/beta receptor 1; human, type I in	91.31
3h63_A		315	Serine/threonine-protein phosphatase 5; metalloenz	91.31
2dtg_E		897	Insulin receptor; IR ectodomain, X-RAY crystallogr	91.27
1fjm_A		330	Protein serine/threonine phosphatase-1 (alpha ISO	91.23
3qfk_A		527	Uncharacterized protein; structural genomics, cent	90.86
2ha1_A		201	Fibronectin; beta sandwich, protein-protein comple	90.56
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	90.51
2v5y_A		731	Receptor-type tyrosine-protein phosphatase MU; mem	90.49
3fl7_A		536	Ephrin receptor; ATP-binding, kinase, nucleotide-b	90.42
4h2g_A		546	5'-nucleotidase; dimer, hydrolase, phosphatase, ex	90.41
3e7a_A		299	PP-1A, serine/threonine-protein phosphatase PP1-al	90.16
3l5h_A		589	Interleukin-6 receptor subunit beta; IG-like, FNII	89.89
3lqm_A		201	Interleukin-10 receptor subunit beta; IL-10R2, com	89.76
2gys_A		419	Cytokine receptor common beta chain; dimer of inte	89.73
2dtg_E		897	Insulin receptor; IR ectodomain, X-RAY crystallogr	89.33
4go6_B		232	HCF C-terminal chain 1; tandem fibronectin repeat,	88.94
3ll8_A		357	Serine/threonine-protein phosphatase 2B catalytic	88.81
2lfe_A		138	E3 ubiquitin-protein ligase HECW2; structural geno	88.48
3uto_A		573	Twitchin; kinase, muscle sarcomere, transferase; H	88.42
3ive_A		509	Nucleotidase; structural genomics, PSI-2, protein	88.41
3c9f_A		557	5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p	87.44
1aui_A		521	Calcineurin, serine/threonine phosphatase 2B; hydr	86.16
3gve_A		341	YFKN protein; alpha-beta-BETA-alpha sandwich, stru	85.42
1bqu_A		215	Protein (GP130); cytokine receptor, glycoprotein 1	85.42
3jyf_A		339	2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n	84.46
2uvf_A		608	Exopolygalacturonase; GH28, pectin, cell WALL, hyd	84.08
2nzi_A		305	Titin; IG-domain, FNIII-domain, transferase; 2.90A	83.97
1t71_A		281	Phosphatase, conserved HYPO; crystal, X-RAY crysta	82.87
1q38_A		89	Fibronectin; amyloid fibril, anastellin, extracell	82.82
3d85_D		306	IL-12B, interleukin-12 subunit P40, cytotoxic lymp	82.14
3lb6_C		380	IL-13, interleukin-13 receptor subunit alpha-2; cy	82.09
4doh_R		221	Interleukin-20 receptor subunit alpha; IL10 family	82.02
4doh_B		206	Interleukin-20 receptor subunit beta; IL10 family	81.57

>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1	Back alignment and structure

Probab=99.98  E-value=8.1e-32  Score=273.63  Aligned_cols=178  Identities=24%  Similarity=0.406  Sum_probs=147.0

Q ss_pred             CCCCCcccEeeeCCC-CCeEEEEEEeC-CCCCCCccEEEEeecCCCCceecccc-eEEeccccCCCCCccccccCCceEE
Q 015747          165 NPNAPVYPRLAQGKV-WNEMTVTWTSG-YGINEAEPFVEWGPKGGDRTYSPAGT-LTFGRGSMCGAPARTVGWRDPGYIH  241 (401)
Q Consensus       165 ~~~~P~qvhLa~~~d-~~sm~VtW~T~-~~~~~~~~~V~yG~~~~~~~~~aa~t-~ty~~~dmcg~pA~t~g~~dpg~iH  241 (401)
                      ++++|+||||+++++ .++|+|+|+|. ..  .+.+.|+||++++.....+.++ .+|...+           +.++|+|
T Consensus        21 ~~~~p~~v~l~~~~~~~~~~~v~W~t~~~~--~~~~~V~y~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~   87 (426)
T 1xzw_A           21 GYNAPQQVHITQGDYEGRGVIISWTTPYDK--AGANKVFYWSENSKSQKRAMGTVVTYKYYN-----------YTSAFIH   87 (426)
T ss_dssp             STTCCEEEEEEECSSSSSCEEEEEEESSCC--TTTTEEEEEETTCCCCEEEECEEECCEETT-----------EECCEEE
T ss_pred             CCCCCceEEEEECCCCCCeEEEEEEeCCCC--CCCCEEEEecCCCCCceEEEEEEEEEEecC-----------CcCCEEE
Confidence            568999999999998 59999999998 53  3578999999877655544443 3344211           2468999


Q ss_pred             EEEeCCCCCCCEEEEEEceecCCCCccccceEEEEeCCCCCCCCceEEEEEecCCCCCCCCCCccccccccchHHHHHHH
Q 015747          242 TGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLI  321 (401)
Q Consensus       242 ~a~LtgL~PgT~Y~YrVG~~~~dg~~~wS~~~sF~T~P~~g~~~~~rfi~fGDmG~~~~dgs~~y~~~qp~s~~t~~~l~  321 (401)
                      +|+|+||+|||+|+|||+++      .||++++|+|+|.+++..++||+++||+|...            .+..+++++.
T Consensus        88 ~v~l~gL~p~t~Y~Yrv~~g------~~s~~~~f~T~p~~~~~~~~~f~~~gD~~~~~------------~~~~~l~~i~  149 (426)
T 1xzw_A           88 HCTIKDLEYDTKYYYRLGFG------DAKRQFWFVTPPKPGPDVPYVFGLIGDIGQTH------------DSNTTLTHYE  149 (426)
T ss_dssp             EEEECCCCTTCEEEEEECCG------GGCEEEEEECCCCCCTTCCEEEEEECSCTTBH------------HHHHHHHHHH
T ss_pred             EEEECCCCCCCEEEEEECCC------CccceeEEECCCCCCCCCCeEEEEEEeCCCCC------------chHHHHHHHH
Confidence            99999999999999999963      48999999999987777789999999998742            1245677777


Q ss_pred             HhcCCCcEEEeecceeccCCC----cchHHHHhhhhhhhhccccEEEcccCccccC
Q 015747          322 QDLKNIDIVFHIGDICYANGY----ISQWDQFTAQIEPIASTVPYMIASGNHERDW  373 (401)
Q Consensus       322 ~~~~~~DfVlh~GDisYa~g~----~~~WD~f~~~iepias~vPym~a~GNHE~d~  373 (401)
                      ++..++|||+|.||++|+++.    ..+|++|++.++++.+.+|+|+++||||+.+
T Consensus       150 ~~~~~~D~vl~~GD~~y~~~~~~~~~~~~~~~~~~l~~l~~~~P~~~v~GNHD~~~  205 (426)
T 1xzw_A          150 QNSAKGQAVLFMGDLSYSNRWPNHDNNRWDTWGRFSERSVAYQPWIWTAGNHEIDY  205 (426)
T ss_dssp             HCTTCCSEEEECSCCCCGGGSGGGCTHHHHHHHHHHHHHHTTSCEECCCCGGGCCC
T ss_pred             hCCCCCCEEEeCCChhhcccCCcccchHHHHHHHHHHHHHhcCCEEEecccccccc
Confidence            644589999999999999875    5689999999999999999999999999986

PyMOL of 1xzw

>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A*	Back alignment and structure

>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis}	Back alignment and structure

>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A*	Back alignment and structure

>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7}	Back alignment and structure

>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A	Back alignment and structure

>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12	Back alignment and structure

>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A	Back alignment and structure

>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6	Back alignment and structure

>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A	Back alignment and structure

>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes}	Back alignment and structure

>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens}	Back alignment and structure

>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A	Back alignment and structure

>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1	Back alignment and structure

>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1	Back alignment and structure

>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A	Back alignment and structure

>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6	Back alignment and structure

>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A	Back alignment and structure

>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1	Back alignment and structure

>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A*	Back alignment and structure

>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A	Back alignment and structure

>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A	Back alignment and structure

>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A	Back alignment and structure

>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7	Back alignment and structure

>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C	Back alignment and structure

>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7	Back alignment and structure

>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A	Back alignment and structure

>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1	Back alignment and structure

>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A	Back alignment and structure

>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7	Back alignment and structure

>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A	Back alignment and structure

>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A	Back alignment and structure

>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens}	Back alignment and structure

>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens}	Back alignment and structure

>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8	Back alignment and structure

>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1	Back alignment and structure

>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A	Back alignment and structure

>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A	Back alignment and structure

>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A	Back alignment and structure

>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens}	Back alignment and structure

>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A	Back alignment and structure

>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens}	Back alignment and structure

>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A*	Back alignment and structure

>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens}	Back alignment and structure

>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A	Back alignment and structure

>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1	Back alignment and structure

>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A	Back alignment and structure

>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A	Back alignment and structure

>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A	Back alignment and structure

>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A*	Back alignment and structure

>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens}	Back alignment and structure

>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1	Back alignment and structure

>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A	Back alignment and structure

>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A	Back alignment and structure

>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0	Back alignment and structure

>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima}	Back alignment and structure

>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A	Back alignment and structure

>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A	Back alignment and structure

>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens}	Back alignment and structure

>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A*	Back alignment and structure

>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens}	Back alignment and structure

>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1	Back alignment and structure

>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A	Back alignment and structure

>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic}	Back alignment and structure

>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A*	Back alignment and structure

>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens}	Back alignment and structure

>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3	Back alignment and structure

>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1	Back alignment and structure

>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B*	Back alignment and structure

>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A	Back alignment and structure

>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C	Back alignment and structure

>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A	Back alignment and structure

>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B*	Back alignment and structure

>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens}	Back alignment and structure

>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A	Back alignment and structure

>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens}	Back alignment and structure

>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B*	Back alignment and structure

>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1	Back alignment and structure

>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum}	Back alignment and structure

>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A	Back alignment and structure

>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1	Back alignment and structure

>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A	Back alignment and structure

>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1	Back alignment and structure

>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1	Back alignment and structure

>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus}	Back alignment and structure

>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A}	Back alignment and structure

>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei}	Back alignment and structure

>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens}	Back alignment and structure

>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A	Back alignment and structure

>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B	Back alignment and structure

>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A	Back alignment and structure

>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A	Back alignment and structure

>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B	Back alignment and structure

>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic}	Back alignment and structure

>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens}	Back alignment and structure

>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens}	Back alignment and structure

>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D*	Back alignment and structure

>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens}	Back alignment and structure

>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens}	Back alignment and structure

>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene}	Back alignment and structure

>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1	Back alignment and structure

>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens}	Back alignment and structure

>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A	Back alignment and structure

>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C*	Back alignment and structure

>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens}	Back alignment and structure

>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens}	Back alignment and structure

>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A	Back alignment and structure

>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A	Back alignment and structure

>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C*	Back alignment and structure

>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A*	Back alignment and structure

>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B*	Back alignment and structure

>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2	Back alignment and structure

>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C*	Back alignment and structure

>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A	Back alignment and structure

>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A*	Back alignment and structure

>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A	Back alignment and structure

>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A*	Back alignment and structure

>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1	Back alignment and structure

>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens}	Back alignment and structure

>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens}	Back alignment and structure

>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A	Back alignment and structure

>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E	Back alignment and structure

>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3	Back alignment and structure

>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp}	Back alignment and structure

>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens}	Back alignment and structure

>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A*	Back alignment and structure

>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A*	Back alignment and structure

>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A*	Back alignment and structure

>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens}	Back alignment and structure

>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens}	Back alignment and structure

>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A	Back alignment and structure

>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E	Back alignment and structure

>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens}	Back alignment and structure

>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A	Back alignment and structure

>2lfe_A E3 ubiquitin-protein ligase HECW2; structural genomics, northeast structural genomics consortiu SGC; NMR {Homo sapiens}	Back alignment and structure

>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A	Back alignment and structure

>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A*	Back alignment and structure

>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2	Back alignment and structure

>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3	Back alignment and structure

>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp}	Back alignment and structure

>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A	Back alignment and structure

>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A*	Back alignment and structure

>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens}	Back alignment and structure

>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9	Back alignment and structure

>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1	Back alignment and structure

>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A*	Back alignment and structure

>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D*	Back alignment and structure

>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens}	Back alignment and structure

>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		401
d2qfra1		112	b.1.12.1 (A:9-120) Purple acid phosphatase, N-term	2e-16
d1xzwa1		119	b.1.12.1 (A:1-119) Purple acid phosphatase, N-term	6e-16
d2qfra2		312	d.159.1.1 (A:121-432) Plant purple acid phosphatas	7e-13
d1utea_		302	d.159.1.1 (A:) Mammalian purple acid phosphatase {	9e-06

>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 112	Back information, alignment and structure


class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Purple acid phosphatase, N-terminal domain
family: Purple acid phosphatase, N-terminal domain
domain: Purple acid phosphatase, N-terminal domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 72.3 bits (177), Expect = 2e-16
 Identities = 24/121 (19%), Positives = 39/121 (32%), Gaps = 22/121 (18%)

Query: 163 FTNP---NAPVYPRLAQG-KVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLT 218
           F  P   NAP    + QG  V   M ++W +          V +  +   R     G ++
Sbjct: 10  FRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEP--GSSAVRYWSEKNGRKRIAKGKMS 67

Query: 219 FGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKAS 278
                              G+IH   +R+L  N  Y Y++      G    +  + F   
Sbjct: 68  ----------TYRFFNYSSGFIHHTTIRKLKYNTKYYYEV------GLRNTTRRFSFITP 111

Query: 279 P 279
           P
Sbjct: 112 P 112

PyMOL of d2qfra1

>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Length = 119	Back information, alignment and structure

>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 312	Back information, alignment and structure

>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Length = 302	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		401
d2qfra1		112	Purple acid phosphatase, N-terminal domain {Kidney	99.89
d1xzwa1		119	Purple acid phosphatase, N-terminal domain {Sweet	99.87
d2qfra2		312	Plant purple acid phosphatase, catalytic domain {K	99.62
d1utea_		302	Mammalian purple acid phosphatase {Pig (Sus scrofa	98.94
d2hy1a1		256	Rv0805 cyclic nucleotide phosphodiesterase {Mycoba	98.22
d1x5aa1		94	Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta	98.09
d1x4xa1		93	Fibronectin type-III domain containing protein 3a,	98.02
d2nxfa1		320	Uncharacterized C17orf48 homolog zgc:64213 {Zebraf	97.98
d1uf3a_		228	Hypothetical protein TT1561 {Thermus thermophilus	97.96
d1x5xa1		96	Fibronectin type-III domain containing protein 3a,	97.93
d3d03a1		271	Glycerophosphodiesterase GpdQ {Enterobacter aeroge	97.9
d2djsa1		95	Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta	97.81
d1x5ka1		111	Neogenin {Human (Homo sapiens) [TaxId: 9606]}	97.8
d1x5la1		98	Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta	97.79
d1qg3a1		92	Integrin beta-4 subunit {Human (Homo sapiens) [Tax	97.78
d1x5fa1		107	Neogenin {Human (Homo sapiens) [TaxId: 9606]}	97.77
d2b5ib2		104	Interleukin-2 receptor beta chain {Human (Homo sap	97.76
d1x5za1		102	Receptor-type tyrosine-protein phosphatase delta,	97.76
d3d48r2		104	Prolactin receptor {Human (Homo sapiens) [TaxId: 9	97.74
d1x4ya1		101	Brother of CDO precursor (BOC) {Mouse (Mus musculu	97.68
d1wf5a1		108	Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}	97.68
d1k85a_		88	Fibronectin type III domain from chitinase A1. {Ba	97.67
d2crza1		97	Fibronectin type-III domain containing protein 3a,	97.67
d1erna2		105	Erythropoietin (EPO) receptor {Human (Homo sapiens	97.67
d1f6fb2		103	Prolactin receptor {Rat (Rattus norvegicus) [TaxId	97.65
d1iarb2		101	Interleukin-4 receptor alpha chain {Human (Homo sa	97.62
d2b5ic1		95	Cytokine receptor common gamma chain {Human (Homo	97.61
d1ii7a_		333	Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	97.59
d1n26a3		104	Interleukin-6 receptor alpha chain, domains 2 and	97.53
d1bqua2		115	Cytokine receptor gp130 cytokine-binding domains {	97.52
d2yvta1		257	Uncharacterized protein Aq_1956 {Aquifex aeolicus	97.5
d1owwa_		93	Fibronectin, different Fn3 modules {Human (Homo sa	97.5
d2haza1		101	Neural cell adhesion molecule 1, NCAM {Human (Homo	97.48
d1va9a1		109	Down syndrome cell adhesion molecule-like protein	97.47
d2gysa2		114	Common beta-chain in the GM-CSF, IL-3 and IL-5 rec	97.46
d1nnwa_		251	Hypothetical protein PF1291 {Archaeon Pyrococcus f	97.4
d1x5ga1		103	Neogenin {Human (Homo sapiens) [TaxId: 9606]}	97.38
d1x3da1		105	Fibronectin type-III domain containing protein 3a,	97.37
d1uena_		125	KIAA0343 protein {Human (Homo sapiens) [TaxId: 960	97.36
d1x5ja1		100	Neogenin {Human (Homo sapiens) [TaxId: 9606]}	97.36
d1v5ja_		108	KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}	97.36
d2vkwa2		93	Neural cell adhesion molecule 1, NCAM {Human (Homo	97.34
d1tdqa2		92	Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}	97.3
d2cuha1		102	Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}	97.3
d2crma1		107	Fibronectin type-III domain containing protein 3a,	97.26
d1fnfa1		94	Fibronectin, different Fn3 modules {Human (Homo sa	97.25
d1x5ha1		119	Neogenin {Human (Homo sapiens) [TaxId: 9606]}	97.2
d1axib2		106	Growth hormone receptor {Human (Homo sapiens) [Tax	97.19
d2d9qb2		105	Granulocyte colony-stimulating factor (GC-SF) rece	97.15
d1tena_		90	Tenascin {Human (Homo sapiens) [TaxId: 9606]}	97.13
d1wfoa1		117	Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}	97.08
d1wisa1		111	Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}	97.06
d2ibga1		95	Hedgehog receptor iHog {Fruit fly (Drosophila mela	97.03
d1wfua_		120	Fibronectin type 3 and ankyrin repeat domains 1 pr	97.03
d1x4za1		108	Brother of CDO precursor (BOC) {Mouse (Mus musculu	97.01
d1j8ka_		94	Fibronectin, different Fn3 modules {Human (Homo sa	97.0
d1ujta_		120	KIAA1568 protein {Human (Homo sapiens) [TaxId: 960	96.98
d1wfta_		123	Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T	96.94
d1uc6a_		109	Ciliary neurotrophic factor receptor alpha {Human	96.91
d1fnha1		90	Fibronectin, different Fn3 modules {Human (Homo sa	96.91
d1cd9b2		106	Granulocyte colony-stimulating factor (GC-SF) rece	96.9
d2fnba_		95	Fibronectin, different Fn3 modules {Human (Homo sa	96.83
d1tdqa3		86	Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}	96.83
d1qg3a2		103	Integrin beta-4 subunit {Human (Homo sapiens) [Tax	96.83
d1tdqa1		93	Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}	96.82
d2cuma1		93	Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}	96.82
d1uema_		117	KIAA1568 protein {Human (Homo sapiens) [TaxId: 960	96.81
d1fnfa2		91	Fibronectin, different Fn3 modules {Human (Homo sa	96.81
d2cuia1		101	Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}	96.8
d1qr4a1		87	Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}	96.78
d1x5ya1		98	Myosin binding protein C, fast-type {Mouse (Mus mu	96.77
d1wk0a_		137	Fibronectin type-III domain containing protein 3a,	96.76
d1fnha3		89	Fibronectin, different Fn3 modules {Human (Homo sa	96.76
d1bpva_		104	Type I titin module {Human (Homo sapiens) [TaxId:	96.75
d1ueya_		127	KIAA0343 protein {Human (Homo sapiens) [TaxId: 960	96.74
d1qr4a2		88	Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}	96.65
d2ic2a1		107	Hedgehog receptor iHog {Fruit fly (Drosophila mela	96.64
d1fnha2		90	Fibronectin, different Fn3 modules {Human (Homo sa	96.64
d1cfba1		100	Neuroglian, two amino proximal Fn3 repeats {Drosop	96.63
d3d85d3		94	The p40 domain of interleukin-12 (IL-12 beta chain	96.63
d1x5ia1		113	Neogenin {Human (Homo sapiens) [TaxId: 9606]}	96.55
d1fnfa3		89	Fibronectin, different Fn3 modules {Human (Homo sa	96.54
d1wfna1		106	Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}	96.44
d2dn7a1		94	Receptor-type tyrosine-protein phosphatase F, PTPR	96.38
d1fnaa_		91	Fibronectin, different Fn3 modules {Human (Homo sa	96.32
d1s3la_		165	Putative phosphodiesterase MJ0936 {Methanococcus j	96.18
d2cspa1		117	Rim binding protein 2 {Human (Homo sapiens) [TaxId	96.04
d2gysa4		100	Common beta-chain in the GM-CSF, IL-3 and IL-5 rec	96.0
d2a22a1		193	Vacuolar protein sorting 29, VPS29 {Cryptosporidiu	95.97
d1su1a_		184	Phosphodiesterase yfcE {Escherichia coli [TaxId: 5	95.94
d1cd9b1		107	Granulocyte colony-stimulating factor (GC-SF) rece	95.74
d1wj3a_		117	Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI	95.68
d3ck2a1		173	Uncharacterized protein SP1879 {Streptococcus pneu	95.65
d1xm7a_		188	Hypothetical protein aq_1666 {Aquifex aeolicus [Ta	95.57
d1z2wa1		182	Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus	95.5
d2dtge1		102	Insulin receptor {Human (Homo sapiens) [TaxId: 960	95.38
d1cfba2		105	Neuroglian, two amino proximal Fn3 repeats {Drosop	94.97
d2dtge3		125	Insulin receptor {Human (Homo sapiens) [TaxId: 960	94.86
d1g5ba_		219	lambda ser/thr protein phosphatase {Bacteriophage	94.42
d3c9fa2		322	5'-nucleotidase (syn. UDP-sugar hydrolase), N-term	94.11
d1fyhb1		98	Interferon-gamma receptor alpha chain {Human (Homo	93.61
d1bqua1		95	Cytokine receptor gp130 cytokine-binding domains {	93.13
d2dtge2		196	Insulin receptor {Human (Homo sapiens) [TaxId: 960	92.03
d1y6kr1		99	Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa	88.34
d1usha2		337	5'-nucleotidase (syn. UDP-sugar hydrolase), N-term	88.15
d2z1aa2		302	5'-nucleotidase (syn. UDP-sugar hydrolase), N-term	83.96

>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Purple acid phosphatase, N-terminal domain
family: Purple acid phosphatase, N-terminal domain
domain: Purple acid phosphatase, N-terminal domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.89  E-value=2.8e-23  Score=174.23  Aligned_cols=99  Identities=25%  Similarity=0.432  Sum_probs=80.7

Q ss_pred             ecCCC---CCCcccEeeeCCC-CCeEEEEEEeCCCCCCCccEEEEeecCCCCceecccce-EEeccccCCCCCccccccC
Q 015747          162 TFTNP---NAPVYPRLAQGKV-WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTL-TFGRGSMCGAPARTVGWRD  236 (401)
Q Consensus       162 ~f~~~---~~P~qvhLa~~~d-~~sm~VtW~T~~~~~~~~~~V~yG~~~~~~~~~aa~t~-ty~~~dmcg~pA~t~g~~d  236 (401)
                      .|.+|   ++|+||||+++++ .++|+|+|+|...  ...+.|+||++++.+...+.+.. +|.           .++.+
T Consensus         9 ~~~~p~~~~~P~qvhlt~~~~~~tsm~VsW~T~~~--~~~~~V~yg~~~~~~~~~a~~~~~~~~-----------~~~~~   75 (112)
T d2qfra1           9 VFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDE--PGSSAVRYWSEKNGRKRIAKGKMSTYR-----------FFNYS   75 (112)
T ss_dssp             GGCCCCSTTCCEEEEEEECSSSSSCEEEEEEESSS--CCCCEEEEEESSSCCCEEEECEEECCB-----------CSSCB
T ss_pred             cccCCCCCCCCccEEEeCcCCCCCEEEEEEECCCC--CCCcEEEEEECCCCCCcEEEEEEEEEE-----------ecccC
Confidence            36665   7899999999987 6999999999764  35799999998877665554432 232           24556


Q ss_pred             CceEEEEEeCCCCCCCEEEEEEceecCCCCccccceEEEEeCC
Q 015747          237 PGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASP  279 (401)
Q Consensus       237 pg~iH~a~LtgL~PgT~Y~YrVG~~~~dg~~~wS~~~sF~T~P  279 (401)
                      .+++|+|+|+||+|||+|+||||++      +||++++|+|+|
T Consensus        76 ~~~~h~v~Lt~L~P~T~Y~YrVG~~------~~S~~~~F~T~P  112 (112)
T d2qfra1          76 SGFIHHTTIRKLKYNTKYYYEVGLR------NTTRRFSFITPP  112 (112)
T ss_dssp             CCEEEEEEECSCCTTCEEEEEECCS------SSCEEEEEECCC
T ss_pred             CcEEEEEEECCCCCCCEEEEEECCC------CceeeEEEEcCC
Confidence            8899999999999999999999963      599999999987

PyMOL of d2qfra1

>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}	Back information, alignment and structure

>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]}	Back information, alignment and structure

>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]}	Back information, alignment and structure

>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]}	Back information, alignment and structure

>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]}	Back information, alignment and structure

>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]}	Back information, alignment and structure

>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure