BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 015757
         (401 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3PZ9|A Chain A, Native Structure Of Endo-1,4-Beta-D-Mannanase From
          Thermotoga Petrophila Rku-1
 pdb|3PZG|A Chain A, I222 Crystal Form Of The Hyperthermostable
          Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
          Rku-1
 pdb|3PZI|A Chain A, Structure Of The Hyperthermostable
          Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
          Rku-1 In Complex With Beta-D-Glucose
 pdb|3PZM|A Chain A, Structure Of The Hyperthermostable
          Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
          Rku-1 With Three Glycerol Molecules
 pdb|3PZN|A Chain A, Structure Of The Hyperthermostable
          Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
          Rku-1 With Citrate And Glycerol
 pdb|3PZO|A Chain A, Structure Of The Hyperthermostable
          Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
          Rku-1 In Complex With Three Maltose Molecules
 pdb|3PZQ|A Chain A, Structure Of The Hyperthermostable
          Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
          Rku-1 With Maltose And Glycerol
          Length = 383

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 34 DPGPKTRELTGFIDDKMFSVDRDRYFRPQPTMF 66
          D G K   + GF+D + +  D++ Y  P+P +F
Sbjct: 54 DMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVF 86


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,446,500
Number of Sequences: 62578
Number of extensions: 396128
Number of successful extensions: 725
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 724
Number of HSP's gapped (non-prelim): 1
length of query: 401
length of database: 14,973,337
effective HSP length: 101
effective length of query: 300
effective length of database: 8,652,959
effective search space: 2595887700
effective search space used: 2595887700
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)