Query         015827
Match_columns 399
No_of_seqs    171 out of 980
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 01:16:02 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/015827.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/015827hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 3.3E-43 7.2E-48  304.2   6.7  128   14-143     1-129 (129)
  2 smart00265 BH4 BH4 Bcl-2 homol  33.3      48   0.001   22.4   2.5   21   23-43      4-24  (27)
  3 KOG1334 WD40 repeat protein [G  21.9 1.1E+02  0.0023   33.6   4.0   90   25-119   303-425 (559)
  4 PF02180 BH4:  Bcl-2 homology r  17.2 1.3E+02  0.0028   20.4   2.2   20   24-43      5-24  (27)
  5 PHA00692 hypothetical protein   12.4      86  0.0019   25.0   0.4   11   12-22     35-45  (74)
  6 PF07960 CBP4:  CBP4;  InterPro  12.3 1.1E+02  0.0024   27.7   1.1   11   21-31     30-40  (128)
  7 cd00490 Met_repressor_MetJ Met  11.3 2.5E+02  0.0054   24.2   2.9   38   21-62     50-87  (103)
  8 cd00952 CHBPH_aldolase Trans-o  10.3 1.6E+02  0.0035   29.4   1.7   18   13-31    109-126 (309)
  9 PRK05264 transcriptional repre  10.0 2.8E+02  0.0062   24.0   2.8   38   21-62     51-88  (105)
 10 PF01340 MetJ:  Met Apo-repress   9.6 2.9E+02  0.0063   23.8   2.7   38   21-62     50-87  (104)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=3.3e-43  Score=304.20  Aligned_cols=128  Identities=55%  Similarity=1.141  Sum_probs=97.3

Q ss_pred             CCCCceecCChHHHHHHHHHHHHhCCCCCC-CceeeccCCCCCCCCchhhhhcCCCceEEEeecccccCCCCCCCceecc
Q 015827           14 MLPGFRFHPTDEELVGFYLKRKIQHRPLPI-ELIKQVDIYKYDPWDLPKELATAGEKEWYFYCPRDRKYRNSARPNRVTG   92 (399)
Q Consensus        14 LPPGFRF~PTDEELV~~YLrrKi~g~plp~-~vI~evDVY~~ePWdLP~~~a~~ge~eWYFFspr~rKy~~G~R~nRatg   92 (399)
                      |||||||+|||+|||.+||++|+.|.+++. .+|+++|||++|||+|+. ....++++||||+++++++.++.|.+|+++
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~-~~~~~~~~~yFF~~~~~~~~~~~r~~R~~~   79 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPA-KFKGGDEEWYFFSPRKKKYPNGGRPNRVTG   79 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHH-HSSS-SSEEEEEEE----------S-EEET
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhh-hccCCCceEEEEEecccccCCccccccccc
Confidence            799999999999999999999999999887 799999999999999995 444577799999999999999999999999


Q ss_pred             cceeeccCCCccEEcCCCCeEEEEEEEEEEeeccCCCCCccCceEeeeecC
Q 015827           93 AGFWKATGTDRPIYSSDGTKCIGLKKSLVFYRGRAAKGIKTDWMMHEFRLP  143 (399)
Q Consensus        93 gG~WKatG~~K~I~s~~G~~vVG~KKtLvFy~Gra~~g~KT~WvMhEYrL~  143 (399)
                      +|+||++|+.++|.+. ++++||+||+|+||.++.+++.||+|+||||+|.
T Consensus        80 ~G~Wk~~g~~~~i~~~-~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   80 GGYWKSTGKEKPIKDP-GGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             TEEEEEECEEEEEEE--TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             ceEEeecccccccccc-cceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            9999999999999987 5689999999999998888899999999999983


No 2  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=33.25  E-value=48  Score=22.38  Aligned_cols=21  Identities=24%  Similarity=0.279  Sum_probs=16.8

Q ss_pred             ChHHHHHHHHHHHHhCCCCCC
Q 015827           23 TDEELVGFYLKRKIQHRPLPI   43 (399)
Q Consensus        23 TDEELV~~YLrrKi~g~plp~   43 (399)
                      .-.|||.+|+.-|+..+..++
T Consensus         4 ~nRelV~~yv~yKLsQrgy~w   24 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGYEW   24 (27)
T ss_pred             chHHHHHHHHHHHHhhcCCCC
Confidence            457999999999997765543


No 3  
>KOG1334 consensus WD40 repeat protein [General function prediction only]
Probab=21.89  E-value=1.1e+02  Score=33.59  Aligned_cols=90  Identities=21%  Similarity=0.319  Sum_probs=48.0

Q ss_pred             HHHHHHHHHHHHhCCCCC--------CCcee------eccCCCCCCCCchhhhhcCCCceEEEeecccccCC--------
Q 015827           25 EELVGFYLKRKIQHRPLP--------IELIK------QVDIYKYDPWDLPKELATAGEKEWYFYCPRDRKYR--------   82 (399)
Q Consensus        25 EELV~~YLrrKi~g~plp--------~~vI~------evDVY~~ePWdLP~~~a~~ge~eWYFFspr~rKy~--------   82 (399)
                      +|.+.-|=.|++..++..        ..++.      ..=+|.+++-||   ++.+.+..-|||.+- .+.+        
T Consensus       303 dqf~RvYD~R~~~~e~~n~~~~~f~p~hl~~d~~v~ITgl~Ysh~~sEl---LaSYnDe~IYLF~~~-~~~G~~p~~~s~  378 (559)
T KOG1334|consen  303 DQFARVYDQRRIDKEENNGVLDKFCPHHLVEDDPVNITGLVYSHDGSEL---LASYNDEDIYLFNKS-MGDGSEPDPSSP  378 (559)
T ss_pred             hhhhhhhcccchhhccccchhhhcCCccccccCcccceeEEecCCccce---eeeecccceEEeccc-cccCCCCCCCcc
Confidence            356666788888765322        11222      112566777777   445666777998443 2222        


Q ss_pred             ---------CCCCCceec-ccceeeccCCCccEEcCCCCeE-EEEEEE
Q 015827           83 ---------NSARPNRVT-GAGFWKATGTDRPIYSSDGTKC-IGLKKS  119 (399)
Q Consensus        83 ---------~G~R~nRat-ggG~WKatG~~K~I~s~~G~~v-VG~KKt  119 (399)
                               .|+|-+|+. |.-+|-+.. +-.|-.++.|.| |+.|++
T Consensus       379 ~~~~~k~vYKGHrN~~TVKgVNFfGPrs-EyVvSGSDCGhIFiW~K~t  425 (559)
T KOG1334|consen  379 REQYVKRVYKGHRNSRTVKGVNFFGPRS-EYVVSGSDCGHIFIWDKKT  425 (559)
T ss_pred             hhhccchhhcccccccccceeeeccCcc-ceEEecCccceEEEEecch
Confidence                     256666654 456774432 233333455554 555553


No 4  
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=17.24  E-value=1.3e+02  Score=20.40  Aligned_cols=20  Identities=30%  Similarity=0.403  Sum_probs=15.9

Q ss_pred             hHHHHHHHHHHHHhCCCCCC
Q 015827           24 DEELVGFYLKRKIQHRPLPI   43 (399)
Q Consensus        24 DEELV~~YLrrKi~g~plp~   43 (399)
                      -.|||.+|+.-|+..+..++
T Consensus         5 nR~lV~~yi~yKLsQrgy~w   24 (27)
T PF02180_consen    5 NRELVEDYISYKLSQRGYVW   24 (27)
T ss_dssp             HHHHHHHHHHHHHHHTTSTS
T ss_pred             HHHHHHHHHHHHhhhcCCCC
Confidence            47999999999997665544


No 5  
>PHA00692 hypothetical protein
Probab=12.35  E-value=86  Score=25.02  Aligned_cols=11  Identities=45%  Similarity=0.685  Sum_probs=8.2

Q ss_pred             CCCCCCceecC
Q 015827           12 DVMLPGFRFHP   22 (399)
Q Consensus        12 ~~LPPGFRF~P   22 (399)
                      ...||||||--
T Consensus        35 veyppgfrfgg   45 (74)
T PHA00692         35 VEYPPGFRFGG   45 (74)
T ss_pred             EecCCCccccc
Confidence            35789999953


No 6  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=12.30  E-value=1.1e+02  Score=27.70  Aligned_cols=11  Identities=55%  Similarity=0.827  Sum_probs=9.6

Q ss_pred             cCChHHHHHHH
Q 015827           21 HPTDEELVGFY   31 (399)
Q Consensus        21 ~PTDEELV~~Y   31 (399)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            59999999875


No 7  
>cd00490 Met_repressor_MetJ Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine.  MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence.  MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Probab=11.30  E-value=2.5e+02  Score=24.17  Aligned_cols=38  Identities=26%  Similarity=0.400  Sum_probs=30.7

Q ss_pred             cCChHHHHHHHHHHHHhCCCCCCCceeeccCCCCCCCCchhh
Q 015827           21 HPTDEELVGFYLKRKIQHRPLPIELIKQVDIYKYDPWDLPKE   62 (399)
Q Consensus        21 ~PTDEELV~~YLrrKi~g~plp~~vI~evDVY~~ePWdLP~~   62 (399)
                      |-|.-||+..-...-..|+|||.    +.|+-+..|.++|+.
T Consensus        50 HATNSELLCEAFLHAfTGQPLP~----D~Dl~K~~~d~iP~~   87 (103)
T cd00490          50 HATNSELLCEAFLHAFTGQPLPD----DADLRKERSDEIPEA   87 (103)
T ss_pred             hcccHHHHHHHHHHHhcCCCCCC----hhhhhhcCcccccHH
Confidence            56777888776667778999997    568999999999984


No 8  
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA). HBPHA catalyzes HBP to salicyaldehyde and pyruvate. This reaction is part of the degradative pathways for naphthalene and naphthalenesulfonates by bacteria. CBPHA is homologous to HBPHA and catalyzes the cleavage of CBP to 2-carboxylbenzaldehyde and pyruvate during the degradation of phenanthrene. They are member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=10.33  E-value=1.6e+02  Score=29.43  Aligned_cols=18  Identities=22%  Similarity=0.335  Sum_probs=14.6

Q ss_pred             CCCCCceecCChHHHHHHH
Q 015827           13 VMLPGFRFHPTDEELVGFY   31 (399)
Q Consensus        13 ~LPPGFRF~PTDEELV~~Y   31 (399)
                      .+|| |.|.|+++||+.||
T Consensus       109 v~~P-~y~~~~~~~l~~yf  126 (309)
T cd00952         109 LGRP-MWLPLDVDTAVQFY  126 (309)
T ss_pred             ECCC-cCCCCCHHHHHHHH
Confidence            3556 67999999999986


No 9  
>PRK05264 transcriptional repressor protein MetJ; Provisional
Probab=9.98  E-value=2.8e+02  Score=23.97  Aligned_cols=38  Identities=26%  Similarity=0.383  Sum_probs=30.6

Q ss_pred             cCChHHHHHHHHHHHHhCCCCCCCceeeccCCCCCCCCchhh
Q 015827           21 HPTDEELVGFYLKRKIQHRPLPIELIKQVDIYKYDPWDLPKE   62 (399)
Q Consensus        21 ~PTDEELV~~YLrrKi~g~plp~~vI~evDVY~~ePWdLP~~   62 (399)
                      |-|.-||+..-...-..|+|||.    +-|+-+..|.++|+.
T Consensus        51 HATNSELLCEAFLHA~TGQPLP~----D~Dl~Kd~~d~ip~~   88 (105)
T PRK05264         51 HATNSELLCEAFLHAFTGQPLPD----DEDLRKERSDEIPEA   88 (105)
T ss_pred             hcccHHHHHHHHHHHHcCCCCCC----hhhhhhcCcccchHH
Confidence            56777888776667778999997    568999999999973


No 10 
>PF01340 MetJ:  Met Apo-repressor, MetJ;  InterPro: IPR002084 Binding of a specific DNA fragment and S-adenosyl methionine (SAM) co-repressor molecules to the Escherichia coli methionine repressor (MetJ) leads to a significant reduction in dynamic flexibility of the ternary complex, with considerable entropy-enthalpy compensation, not necessarily involving any overall conformational change []. MetJ is a regulatory protein which when combined with S-adenosylmethionine (SAM) represses the expression of the methionine regulon and of enzymes involved in SAM synthesis. It is also autoregulated. The crystal structure of the met repressor-operator complex shows two dimeric repressor molecules bound to adjacent sites 8 base pairs apart on an 18-base-pair DNA fragment. Sequence specificity is achieved by insertion of double-stranded antiparallel protein beta-ribbons into the major groove of B-form DNA, with direct hydrogen-bonding between amino-acid side chains and the base pairs. The repressor also recognises sequence-dependent distortion or flexibility of the operator phosphate backbone, conferring specificity even for inaccessible base pairs [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0006555 methionine metabolic process; PDB: 1MJO_D 1CMB_A 1MJQ_C 1CMC_B 1MJK_A 1MJ2_A 1MJP_A 1MJM_B 1CMA_B 1MJL_A ....
Probab=9.58  E-value=2.9e+02  Score=23.82  Aligned_cols=38  Identities=32%  Similarity=0.482  Sum_probs=23.8

Q ss_pred             cCChHHHHHHHHHHHHhCCCCCCCceeeccCCCCCCCCchhh
Q 015827           21 HPTDEELVGFYLKRKIQHRPLPIELIKQVDIYKYDPWDLPKE   62 (399)
Q Consensus        21 ~PTDEELV~~YLrrKi~g~plp~~vI~evDVY~~ePWdLP~~   62 (399)
                      |-|.-||+..-...-..|+|||.    +.|+-+..|.++|..
T Consensus        50 HATNSeLLcEAFLHAfTGQPLP~----D~dl~kd~~d~ip~~   87 (104)
T PF01340_consen   50 HATNSELLCEAFLHAFTGQPLPT----DDDLRKDRPDEIPAE   87 (104)
T ss_dssp             S-SHHHHHHHHHHHHHH----------TTGGGSTSGSSS-HH
T ss_pred             hcccHHHHHHHHHHHhcCCCCCC----hhhhhhcCCccchHH
Confidence            56778888776667779999997    568999999999983


Done!