Citrus Sinensis ID: 015838


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MAGGSDAAETTSLSCVRCGKPAHLQCPKCMELKLPREGAAFCTQDCFKASWTSHKSVHLKAKLSAPGTGENSSLVSEGWRYCIKKGQARTPKLPHFDWTGTLRPYPISSKLTVPAYIELPDWALDGTPKVEPNSDLQHVVEIKTPDQIERMRETCRIAREVLDAAARMIRPGVTTDEIDRVVHEATITAGGYPSPLNYHFFPKSCCTSVNEVICHGIPDSRKLEDGDIVNIDVTVYYKGVHGDLNETYFVGNADEASRQLVQCTYECLEKAISIVKPGVRFREIGEVINRHATMSGFSVVKSYCGHGIGELFHCAPNIPHYSRNKAVGVMKVGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLNA
cccccccccccccccccccccccccccccccccccccccEECcHHHHcccHHHHHHHHHHccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccccccEEEEEEEEEcccEEcccccEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEccccccccccccccccccccccccccccccccccEEEEcccccccccccEEcccccCEEcccccccccccEEEEEcccccEEECccccccccccccccc
************LSCVRCGKPAHLQCPKCMELKLPREGAAFCTQDCFKASWTSHKSV*********************WRYCIKKGQARTPKLPHFDWTGTLRPYPISSKLTVPAYIELPDWALDGTPKV*****LQHVVEIKTPDQIERMRETCRIAREVLDAAARMIRPGVTTDEIDRVVHEATITAGGYPSPLNYHFFPKSCCTSVNEVICHGIPDSRKLEDGDIVNIDVTVYYKGVHGDLNETYFVGNADEASRQLVQCTYECLEKAISIVKPGVRFREIGEVINRHATMSGFSVVKSYCGHGIGELFHCAPNIPHYSRNKAVGVMKVGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPK*YPWL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGGSDAAETTSLSCVRCGKPAHLQCPKCMELKLPREGAAFCTQDCFKASWTSHKSVHLKAKLSAPGTGENSSLVSEGWRYCIKKGQARTPKLPHFDWTGTLRPYPISSKLTVPAYIELPDWALDGTPKVEPNSDLQHVVEIKTPDQIERMRETCRIAREVLDAAARMIRPGVTTDEIDRVVHEATITAGGYPSPLNYHFFPKSCCTSVNEVICHGIPDSRKLEDGDIVNIDVTVYYKGVHGDLNETYFVGNADEASRQLVQCTYECLEKAISIVKPGVRFREIGEVINRHATMSGFSVVKSYCGHGIGELFHCAPNIPHYSRNKAVGVMKVGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLNA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methionine aminopeptidase 1A Removes the N-terminal methionine from nascent proteins.confidentQ9SLN5
Methionine aminopeptidase 1 Removes the N-terminal methionine from nascent proteins.probableQ5I0A0
Methionine aminopeptidase 1 Removes the N-terminal methionine from nascent proteins.probableQ8BP48

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.11.-Aminopeptidases.probable
3.4.11.18Methionyl aminopeptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B3H, chain A
Confidence level:very confident
Coverage over the Query: 96-391
View the alignment between query and template
View the model in PyMOL
Template: 2OD1, chain A
Confidence level:confident
Coverage over the Query: 10-58
View the alignment between query and template
View the model in PyMOL