BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 015842
(399 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2GZA|A Chain A, Crystal Structure Of The Virb11 Atpase From The Brucella
Suis Type Iv Secretion System In Complex With Sulphate
pdb|2GZA|B Chain B, Crystal Structure Of The Virb11 Atpase From The Brucella
Suis Type Iv Secretion System In Complex With Sulphate
pdb|2GZA|C Chain C, Crystal Structure Of The Virb11 Atpase From The Brucella
Suis Type Iv Secretion System In Complex With Sulphate
Length = 361
Score = 28.9 bits (63), Expect = 5.1, Method: Compositional matrix adjust.
Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
Query: 221 MKALELWRESPAVL-LCIRRPGCIMC-RAEAHQLYAKKPIFDALGIQLFAVLHEYIESEV 278
++ L W + P + +C+ RPG + C RA A + YA + I L +++ ++
Sbjct: 26 LEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDI 85
Query: 279 KDFWP 283
D P
Sbjct: 86 SDSRP 90
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.135 0.399
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,605,175
Number of Sequences: 62578
Number of extensions: 394882
Number of successful extensions: 791
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 791
Number of HSP's gapped (non-prelim): 3
length of query: 399
length of database: 14,973,337
effective HSP length: 101
effective length of query: 298
effective length of database: 8,652,959
effective search space: 2578581782
effective search space used: 2578581782
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)