Citrus Sinensis ID: 015857

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40

MPSQILPVTHHHRGTEAAAMLIKAEIERDDPTTSLLISSEYEDVEKAITSIKPVLSRTSSYNNNNITSPNDSPGLGNCYQQRRRRSASDNSLSSLSGSNGSGAASSAGGSRRHSFSKDVGRAAAETFLVTRLSFKLLRYLGVGYRWIVRFLALGCYSLLLLPGFIQVGCHYFFSSQVRRGIVYGDQPRNRLDLYFPKSSDGPKPVVAFITGGAWIIGYKAWGSLLGQQLSERDIIVACIDYRNFPQGTIKDMVKDASQGISFVCNNISEYGGDPDRIYLMGQSAGAHIAACTLLEQAIKETGEGESTTWSVSQIRAYFGLSGGYNLFDLVDHFHSRGLYRSIFLSIMDGEESLRQYSPEVLVQDPNTRHAVSLLPPIILFHGTADYSIPADARFYSPLK

cccccccccccccccHHHHHHHHHHHccccccccEEEccccHHHHHHHHcccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccEEEECcccccccccEEEEEEcccccccccccccHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccccccccccccccccHHHHHHHHcccccHHHHccccHHHHccccccccccccccEEEEECcccccccccHHHHHHcc

*********HHHRGTEAAAMLIKAEIERDDPTTSLLISSEYEDV**********************************************************************FSKDVGRAAAETFLVTRLSFKLLRYLGVGYRWIVRFLALGCYSLLLLPGFIQVGCHYFFSSQVRRGIVYGDQPRNRLDLYFPKSSDGPKPVVAFITGGAWIIGYKAWGSLLGQQLSERDIIVACIDYRNFPQGTIKDMVKDASQGISFVCNNISEYGGDPDRIYLMGQSAGAHIAACTLLEQAIKETGEGESTTWSVSQIRAYFGLSGGYNLFDLVDHFHSRGLYRSIFLSIMDGEESLRQYSPEVLVQDPNTRHAVSLLPPIILFHGTADYSIPADARFYSPLK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2	Catalyzes the demethylation of isoprenylcysteine methylesters.	probable	Q5VNW5
Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1	Catalyzes the demethylation of isoprenylcysteine methylesters. May be involved in the regulation of ABA signaling.	probable	Q8VYP9

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C7B, chain A
Confidence level:very confident
Coverage over the Query: 188-300,311-397
View the alignment between query and template
View the model in PyMOL

Template: 3BJR, chain A
Confidence level:confident
Coverage over the Query: 180-330,345-398
View the alignment between query and template
View the model in PyMOL