Citrus Sinensis ID: 015937

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40

MEALRLSSVSPFCNATFKLEYNKTHFTKPKFLSFQFSSLSTLSSFSSKPYKIFTTLSPSSQVSTEATDPPERELETNSQEEKFDWFSQWYPLMPVCDLDKRVPHAKKVLGLDVVVWWDRNENEWRVFADACPHRLAPLSEGRIDQWGRLQCVYHGWCFSGSGDCKFIPQAPPDGPPVHTFEKACAAVYPSTVQHDIVWFWPNIAPRYKDIIKTKKPPHIPELDDPSFTKLFGNRDIPYGYEVLLENLMDPAHVPYAHYGLMRTRKPKVKLDREGGRPVEMSVNKIDINGFIGKQEWGSSKFLAPCIFFAYTDLMKDQENGSASSAGAEKKLEQQRAALIFICVPVSPGHSRLIWAFPRNFQTWIDKVVPRWIFHIGQNLILDSDLYLLHVEVIPVSVC

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEECcccccccccCEEEEccccEEEEEEcccccEEEEccccccccccccccEEccccEEEcccccEEEcccccEEEccccccccccccccccccccECcEEEEccEEEEEccccccccccccccccccccccccccccEEEEEEEECcccHHHHHHcccccccccccccccccccccCEEECcccCEEEEEEEECcccccccccccccccccccCEEEEEEcccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEECcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccc

*********SPFCNATFKLEYNKTHFTKPKFLSFQ***********************************************FDWFSQWYPLMPVCDLDKRVPHAKKVLGLDVVVWWDRNENEWRVFADACPHRLAPLSEGRIDQWGRLQCVYHGWCFSGSGDCKFIPQAPPDGPPVHTFEKACAAVYPSTVQHDIVWFWPNIAPRYKDIIKTKKPPHIPELDDPSFTKLFGNRDIPYGYEVLLENLMDPAHVPYAHYGLMRTRKPKVKLDREGGRPVEMSVNKIDINGFIGKQEWGSSKFLAPCIFFAYTDLMKDQENGSASSAGAEKKLEQQRAALIFICVPVSPGHSRLIWAFPRNFQTWIDKVVPRWIFHIGQNLILDSDLYLLHVEVIPV***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protochlorophyllide-dependent translocon component 52, chloroplastic	Part of a translocon most abundantly expressed in etiolated plants and involved in the protochlorophyllide-dependent import of the precursor NADPH:protochlorophyllide oxidoreductase A (pPORA).	probable	Q8W496

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZYL, chain A
Confidence level:very confident
Coverage over the Query: 81-317,332-394
View the alignment between query and template
View the model in PyMOL

Template: 3N0Q, chain A
Confidence level:very confident
Coverage over the Query: 72-311,334-397
View the alignment between query and template
View the model in PyMOL